Identifiers and Description

Gene Model Identifier

Contig980.0.g21

Standard Name

RPS7

Aliases

Contig980_0_g21

Description

Ribosomal protein S7e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL096C3.0010664139725277e-29RPS7B SGDID:S000005040, Chr XI
V from 443826-443398,4443...
T. thermophilaTTHERM_004710906.9997332827772725e-22hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig980.0.g21(coding)
ATGTTCCACGCAAGAAGCAAGATCATTAAGAAGGACGATACCAAGCCTACCGATTTGGAA
GATGAAGCTGCCAAGTGCCTATAATAATTAGAGATGAACAATGCCAACTTGAAAGAGCAT
TTATCTCAGATCTTCATTAACAGCGCAGATTTATAAGAATATGAGCAACAAGACGGTTCA
AGAAGCAAGTGCCTCCTCGTGAAGATTCCATACAGATCAATCACTGCTTTCCGCAAGGTC
AGTGACAAGGTCGTCCACCACCTCGAGAGCAAGTTCAACTGGCCAGTCATCGTTGTCGCC
ACCAGAACCATCATCTCAAAGAGAGCTAAGAGAAACAGAACTCAAAAGAGACCCAGAAGC
AGAACTTTGACTGCCGTCCACGCAGCAACTCTAGAAGATATTGTTTACCCAGCCACCATC
ACTGGAAGATCAACCAGAGTTACCCTCGACGGTAAGAAGCACATGAAGCTCTTCTTGGAC
CCACTCGACAAGGAGAAGGTTGAGAACAAGATTGACGCCATGGCTCAAATCTACCACAAG
ATCACCACCCACAAGATCTCCATCCACTTCTCAAAGCCCAACTCTTTCCAAAAGAAGGTT
ATGGACGCCAAGAAGCAATGA


>Contig980.0.g21(protein)
MFHARSKIIKKDDTKPTDLEDEAAKCLQQLEMNNANLKEHLSQIFINSADLQEYEQQDGS
RSKCLLVKIPYRSITAFRKVSDKVVHHLESKFNWPVIVVATRTIISKRAKRNRTQKRPRS
RTLTAVHAATLEDIVYPATITGRSTRVTLDGKKHMKLFLDPLDKEKVENKIDAMAQIYHK
ITTHKISIHFSKPNSFQKKVMDAKKQ