Identifiers and Description

Gene Model Identifier

Contig14465.0.g80

Standard Name

RPS6

Aliases

Contig14465_0_g80

Description

Ribosomal protein S6e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001497989.997093137033517e-262EVM3 model
SGDYPL090C4.99780462713828e-94RPS6A SGDID:S000006011, Chr XV
I from 377995-377291,3783...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14465.0.g80(coding)
ATGTCAACCATGAAATTCAACGTTTCGTATCCAGTTACTGGTCTTCAAAAGAAAATTGAG
ATTGACGACGACAAGAAGATTCGTCACTTCTACGATAAGAGAATGGGACAGGAAGTCGAC
GGAGAAGTTTTAGGAGAATAGTACAAAGGATACATTTTCAGAATCACCGGTGGTAACGAC
AAGCAAGGTTTCCCCATGAAACAAGGAGTCTTGGTCAACGGAAGAGTCAGACTTCTCCTC
AAGAAGCAGACAACTACTTACAGACCCAGAAGAACTGGAGAGAGAAAGAGAAAGTCAGTC
AGAGGCTGCATCTGCGGTCCAGATCTTGCCGTTATTGCCCTTAGAATCGTCAAGAAGGGT
GATGCTGAGATTGAAGGTATTACTGACAGCGATAAGCCAAGAAGACTCGGCCCCAAGAGA
GCCAACTACATCAGAAAGGTCTTCAACCTCAGAAAGAGCGATGATGTTAGAAAGTACGTC
GTGAGAAGAGAAGTCAAGAAGGGAGACAAGACCTTCTACAAATCACCAAAGATCCAAAGA
CTCGTCACTGAGAAGAGATTGAGAAGAAAACAATTGATCAAGAGAGAGAAGCTCAACAGA
TTCAAGAAATCCAAGGAAGAGAAAGCCAAGTACGACAAGGTCCTCTCCAAGTACATCAAG
GAGAAGAAAGCTGCTCATCACGCTCATGCCGCACCAGAGACCACCGCCGCTCCAGCTGCT
CCAGTCAAGACCGCTCCAGCCAAGGAAGCACCAAAGAAGACTGAAGCTAAGGTTGTTGCC
CCAAAGAAGAAGTGA


>Contig14465.0.g80(protein)
MSTMKFNVSYPVTGLQKKIEIDDDKKIRHFYDKRMGQEVDGEVLGEQYKGYIFRITGGND
KQGFPMKQGVLVNGRVRLLLKKQTTTYRPRRTGERKRKSVRGCICGPDLAVIALRIVKKG
DAEIEGITDSDKPRRLGPKRANYIRKVFNLRKSDDVRKYVVRREVKKGDKTFYKSPKIQR
LVTEKRLRRKQLIKREKLNRFKKSKEEKAKYDKVLSKYIKEKKAAHHAHAAPETTAAPAA
PVKTAPAKEAPKKTEAKVVAPKKK