Identifiers and Description

Gene Model Identifier

Contig1487.0.g85

Standard Name

RPS5

Aliases

Contig1487_0_g85

Description

Ribosomal protein S7p/S5e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_013860501.0002223712504345e-79ribosomal protein S7 containin
g protein
SGDYJR123W2.0001503375893664e-79RPS5 SGDID:S000003884, Chr X f
rom 651901-652578, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1487.0.g85(coding)
ATGGTTGACAATACATCAGACAACGGAGACGCTAGAGCTGAAGAACAAACAATTTCATAC
GCCACCGAGGTTAAACTCTTCGGCAAATGGTCATACGAAAACGTACAATCCAAGGACATC
TCCCTCATGGCCTACTTGAACGTCAAAACTATTAAGGCTCAAGTTTTCTTGCCCTTCACT
GCTGGCAGATATCAAAAGAGAAGTTTCCAAAAGGTGAACTGCCCCATTATCGAACGTCTT
ATTAACGGATTAATGAGCAAGGGTAGAAACACTGGTAAGAAGCAATTAGCCATCAGAATC
GTGAAGCAAGCCCTCGAAATCCTCGCCCTTACCACCGGTGAGAACCCTATTCAAATTGTC
ATCGACGCTATCAGCAACGGAGGTGCCAGAGAAGACTCAACCAGAATCGGTACTGGTGGT
GTCGTCAGAAGACAAGCCGTCGACGTTTCACCCATTAGAAGAGTGAATCAAGCTATTTAC
TTGATGACCAAGGGTGCCAGAGAGTCCTCATTCAGAACCATTAAGTCCATGAGCGAGATC
TTAGCTGATGAACTTTTGGCCGCCTCAAAGGGTTCAGGTTCAGGTGCCAACTCTCATGCT
GTCAAGAAGAAGGACGAAATCGAAAGAGTTGCCAAGGGTAACCGTTGA


>Contig1487.0.g85(protein)
MVDNTSDNGDARAEEQTISYATEVKLFGKWSYENVQSKDISLMAYLNVKTIKAQVFLPFT
AGRYQKRSFQKVNCPIIERLINGLMSKGRNTGKKQLAIRIVKQALEILALTTGENPIQIV
IDAISNGGAREDSTRIGTGGVVRRQAVDVSPIRRVNQAIYLMTKGARESSFRTIKSMSEI
LADELLAASKGSGSGANSHAVKKKDEIERVAKGNR