Identifiers and Description

Gene Model Identifier

Contig21054.0.g58

Standard Name

RPS4

Aliases

Contig21054_0_g58

Description

Ribosomal family S4e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR145C2.999180586171967e-98RPS4A SGDID:S000003906, Chr X
from 702798-702027,703068...
T. thermophilaTTHERM_001493005.000729663236884e-95Ribosomal family S4e containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21054.0.g58(coding)
ATGGCAAGAGGACCCAAGAAGCATCAAAAGAGAATCGCAGCCCCATCCCACTGGATGTTG
AACAAATTAGGAGGAGTTTACGCCACCAGAGCCGGTACCGGTCCCCACAAGAGAAGGGAA
AGCATGCCACTATCTGTACTCCTTAGAAATAGATTGAGATATGCAATTTCTCGTCAAGAG
GCTATTAAGATCGTTAAAGACAAGGAAGGACTCATCAAGATCGACGGCAAGATCAGAAGA
GACCCCAGATTCCCACTCGGTATTATGGACGTTGTCACCATTGACAGAACTGGAGAACAC
TTCAGAATCCTCTACGACGTCAAGGGTAGATACCAAGCTCACAAGATCGACGCCAAGGAA
GCTCAATTCAAGCTCTGCTCCATCAGAAGAAAGGCCATGGGACCCAACAAAGTTCCCTAC
GTTATTACCCACGACGGCAGAACCCTCAGATTCCCCCACCCAGACATCAAGAAGCACGAT
ACCGTCAAGTTGAATCTCGAGACAAACGAAGTTGAGAGCCTCATTAAGTTCGAGAACGGA
GCTCAAGTTCTCCTCGTCGGTGGTAACAACATCGGAAGAGTCGGTGTTCTCCAACACATC
GAAAAGCATCCAAGCAGCTTCGATATTGCTCACATCAAGGACGCCGCAGGACACTCCTTC
GCCACCAGAGTCAACAACGTCTTCGTTATCGGAGAGGGCAAAAAGTCCGTCATCTCACTC
CTCCCAGCCAAGGGTATCAAGCTTTCCCTCATCGACGAGAGAAACAAGAGACTCAGAATT
GAAGCTGACGAATGA


>Contig21054.0.g58(protein)
MARGPKKHQKRIAAPSHWMLNKLGGVYATRAGTGPHKRRESMPLSVLLRNRLRYAISRQE
AIKIVKDKEGLIKIDGKIRRDPRFPLGIMDVVTIDRTGEHFRILYDVKGRYQAHKIDAKE
AQFKLCSIRRKAMGPNKVPYVITHDGRTLRFPHPDIKKHDTVKLNLETNEVESLIKFENG
AQVLLVGGNNIGRVGVLQHIEKHPSSFDIAHIKDAAGHSFATRVNNVFVIGEGKKSVISL
LPAKGIKLSLIDERNKRLRIEADE