Identifiers and Description

Gene Model Identifier

Contig850.1.g11

Standard Name

RPS3A

Aliases

Contig850_1_g11

Description

Ribosomal S3Ae family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR441C7.997481627602355e-72RPS1A SGDID:S000004433, Chr XI
I from 1018908-1018141, G...
T. thermophilaTTHERM_000474803.0012565309061457e-65Ribosomal S3Ae family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig850.1.g11(coding)
ATGACAGCCGGTAAAAATCCAAGAAGCTTCAAGAAGAAGGGCCAAAAGAAGAAGGTCGTT
CACTCCTTCGCCAAGAAAGAATGGTACAACATCCACGTTCCTACCGTTTTCGACACTAGA
GTCCCAACCATTACTCCTTGCAACAGAACTGCTGGTCAAAGTAAGTCTTCACTTTCTCAA
ACCAGCGTATTAACCATGTTTGTTTGTATAGAGCACGCTTCTGACAGCTTGAAAGGTCGT
GTGTTCGAGATATCTTTGGCCGATTTGAACAGAGAGAGCAACGATTAAGCCTGGAGAAAA
ATGAAGGTGCAAATCGAGGAAGTGAAAGGTTTCGATTGCTACACTAACTTCTACGGTATG
GACATCACCAGAGATAAGTTGTGCACCATTGTCAAGAAATGGCACACCACCGTTGAGGCC
TTCGTGCAAACCAAGACCGCTGATGGATACCTCCTCAGAATGTTCGCCATTGGCTTCACC
CAAAGAACAAGAAAGCAAGTCAGCGCTACCTGCTACGCTAAGGGCTCCCAAAGAAAGCTC
ATCCGCAAGAAGATGATGGAAATTATGATTAACGAGGCCCAGAAATCCACTCTGAAAGAG
CTTACCAAGAAATTCGTTTCCGACACTATTGGAAAGGAAATCCAAAAGCAATGTGGCAAG
ATCTTCCCACTCCAAAACGTCCTCGTAAGAAAGGTCAAGCTCCTCAAGAAACCCAAGTTC
GATCTCACCAAGCTCATGGAGCTCTATCAAGAGAAGCCAGAACTCGAGATCAAGGGCAAG
AAAGAAGCCAAGGAAGAGCCAAAGAACAAGCTCGTCGGCGACGCCAAATGA


>Contig850.1.g11(protein)
MTAGKNPRSFKKKGQKKKVVHSFAKKEWYNIHVPTVFDTRVPTITPCNRTAGQSKSSLSQ
TSVLTMFVCIEHASDSLKGRVFEISLADLNRESNDQAWRKMKVQIEEVKGFDCYTNFYGM
DITRDKLCTIVKKWHTTVEAFVQTKTADGYLLRMFAIGFTQRTRKQVSATCYAKGSQRKL
IRKKMMEIMINEAQKSTLKELTKKFVSDTIGKEIQKQCGKIFPLQNVLVRKVKLLKKPKF
DLTKLMELYQEKPELEIKGKKEAKEEPKNKLVGDAK