Identifiers and Description

Gene Model Identifier

Contig16083.0.g100

Standard Name

RPS30

Aliases

Contig16083_0_g100

Description

Ribosomal protein S30

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005264500.00000000000040012475857291343Ribosomal protein S30 containi
ng protein
SGDYOR182C0.0000000000599805963605737RPS30B SGDID:S000005708, Chr X
V from 678379-678191,6787...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16083.0.g100(coding)
ATGGGAAAAGTACATGGATCCATGGCTAGAGCTGGTAAAGTCAGAAATCAAGCCCCAAAG
GTCGACAAGACTGAGAGAGCAAAGAAGAGAGTAACTGGAAGAGCCAAGAAGAGACTTCAA
TACAAGAAAAGAATCGTGAACGTTGACCCCAACGACAAGAGAAAGAAGGGACCCAACTTC
GGCGCTGGAAAGAAGATCACTCTTGCTCCATGA


>Contig16083.0.g100(protein)
MGKVHGSMARAGKVRNQAPKVDKTERAKKRVTGRAKKRLQYKKRIVNVDPNDKRKKGPNF
GAGKKITLAP