Identifiers and Description

Gene Model Identifier

Contig3798.0.g42

Standard Name

RPS3

Aliases

Contig3798_0_g42

Description

Ribosomal protein S3, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011515002.999277470785175e-69KH domain containing protein
SGDYNL178W9.996907204735647e-62RPS3 SGDID:S000005122, Chr XIV
from 302680-303402, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3798.0.g42(coding)
ATGGCCTCAACCGGAGAAAAGAGAGTTAGAAAGATCAACACCAAGAAGAAGTTCGTTGCC
GATGGAGTCTTCCAAGCTGAATTGAACGAATTCCTTACCAGATGCCTCGGTATGGACGGT
TACGCCGGTATCGAAGTCAGAGCCACCTCCATGAGCACTGAGATCAGAGTCAAGGCCACC
AAGACCAGAGAAATCCTCGAAAAGAGTGCCAGAAAGGTCAGAGAACTCAAGTCACTCATT
GAGAAGAGATACAACTTCAACGATGTTGACAACAAAGTTGAACTCGCCATCAAGCCACTC
CCATACGACAAGAACTTGTGCGCTGCTGCTCAAGCTGAGAACCTTAAGTACAAGCTCCTC
GGAGGTACCCCAGTCAGACTCGCTGCCAACAACATCCTCGCTCAAGTCATGAAGAGAGGT
GGAGCCAAGGGTTGCGAAATCATCATCTCAGGTAAGATCAGAGGTCAAAGAGCAAAGTCC
CAAAAGTACAAGCAAGGATATATCATCTCCACTGGTCAACCAAAGCTCGAATTCGTTGAT
GAAGCCGTTCGTCACGTTGAACTCAGACAAGGTGTCCTCGGAGTCAAGGTCAAGATTCTC
CCAGACACTGAGAGAGCCGTCGGCAAATATAGAAAGATCATGCCCGATTACGTCAAGATC
CACGAGCCAAAGGACGACCACCACGACATCACCCCAACCGGTATCCCAGCTCACTCAAGA
GACCAACAATGA


>Contig3798.0.g42(protein)
MASTGEKRVRKINTKKKFVADGVFQAELNEFLTRCLGMDGYAGIEVRATSMSTEIRVKAT
KTREILEKSARKVRELKSLIEKRYNFNDVDNKVELAIKPLPYDKNLCAAAQAENLKYKLL
GGTPVRLAANNILAQVMKRGGAKGCEIIISGKIRGQRAKSQKYKQGYIISTGQPKLEFVD
EAVRHVELRQGVLGVKVKILPDTERAVGKYRKIMPDYVKIHEPKDDHHDITPTGIPAHSR
DQQ