Identifiers and Description

Gene Model Identifier

Contig22313.0.g6

Standard Name

RPS29

Aliases

Contig22313_0_g6

Description

Ribosomal protein S14p/S29e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL061C3.9992896861436003e-19RPS29B SGDID:S000002219, Chr I
V from 340798-340628, Gen...
T. thermophilaTTHERM_000370908.000721090200152e-18hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22313.0.g6(coding)
ATGCCAAATCAATTACATAGTCACCCCAGAAAGTACGGAAAGGACTCAAGAGCCTGCAGA
GTTTGCAACAATACCCATGGTCTTATCAGAAAGTACTAACTCATGGTCTGCAGAAGATGC
TTCAGAGAGAATGCTAACTTGATCGGCTTCTACAAGTACCGTTGA


>Contig22313.0.g6(protein)
MPNQLHSHPRKYGKDSRACRVCNNTHGLIRKYQLMVCRRCFRENANLIGFYKYR