Identifiers and Description

Gene Model Identifier

Contig12436.0.g46

Standard Name

RPS28

Aliases

Contig12436_0_g46

Description

Ribosomal protein S28e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR167C9.997975313387782e-28RPS28A SGDID:S000005693, Chr X
V from 649007-648804, Gen...
T. thermophilaTTHERM_001053302.99851380290819e-19Ribosomal protein S28e contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12436.0.g46(coding)
ATGGACAACCAAGGAGAAATTACTTATGCTGAAGTCAAAGAAATCATCGGCAAGACTGGT
TCCAGAGGAGGTATCACTCAGGTGAAAGTTGTGTTCATGAACGACACCAAGAGAAGTTTG
GTGAGAAATGTCAAGGGCCCCGTCAGAAAGGGAGACATCCTCGCTCTTTTAGAATCAGAA
AGAGAAGCCAGAAGACTCAGATGA


>Contig12436.0.g46(protein)
MDNQGEITYAEVKEIIGKTGSRGGITQVKVVFMNDTKRSLVRNVKGPVRKGDILALLESE
REARRLR