Identifiers and Description

Gene Model Identifier

Contig4448.0.g28

Standard Name

RPS27L

Aliases

Contig4448_0_g28

Description

Ribosomal protein S27

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR021C8.999219783133462e-31RPS27B SGDID:S000001063, Chr V
III from 148116-147871,14...
T. thermophilaTTHERM_010430900.000000000004997916451710233hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4448.0.g28(coding)
ATGGGTTGCTGTATGTCGGTTTAATCAACCTAAAGCCCTTAAAAGTTAAACTTTGAATCT
TAAAATATGGCAAGTAGCCCTATACCATAAAGTAATCAATAAATAATAAAAGTCAAGAGA
CAGTTATAAGAAAGCTTTAAGAAGTAGCAGATACCTCTTTCATAAAAGCTAAAAGATACT
CTGCAAAAAATCAATTCAAAAGGGCAGTTCCCTTGTAGATTTGTAGGCTTGCATTTTATT
CATAACTACTTAATGTTTGTGAGAGAAAGAATTATTCCAGAAAAGAATGAGCTTCTGATC
TTTGATCTCAGAGATAAGCAACAAATCAATGAATTTAGAATATTGAAAAGTTAGTAAATA
CAGCCAGATTAAGTTGTGCATAATTAGGAAACTCTATCCTTATTCAAGCAGCAAATTCAT
TTTAAGTACATTTTCATGATTGGTGAGTCAAAAGATTTTGATTCTGCTTCTTTTACAGAA
CTCATGAATCAAATTATCGACCTAGAAATGAAGCCATTTTGCTTTTATTTACATCGGCTT
AAGTAAGAATTGGTGGAAGCTGAATTTCCACATTTAATCATCAGAGGCCACGAAAAGAGG
AAGCTTGGATATTATCCTCAAATAATTGTAAAGTGTAAAGATATGGGACTTGAAAAATCT
AAGAATAAGTTCTAGATTTTAATGGCAAACAGCTAAATTATAAGGGCACAATAAGTTTTA
GAAATGTAAATCACAAAGGCAATATAAATTGATGATGAGAGCAGTTTTAGTCCAGGAAAG
AAGCAGGAAGGTCTGTAAGGTTTACTTAAAGAACGAAGAATCTCAGTGAACATTGTTGAC
ATAATTTGTGATATTTTGAAGGAGTTCTCTTAAGAGAAAAACAATGGAAGTTAAGCAATA
TAAATGGTTAAAATAAATGCTAACATTAAGAGAAATGATGAGAAGAGCTTCAAAGAGAAG
TTAATCGATCAAATGAAACTGCTTCATGTTGAATAGAAGAAAATTTTGGCAAAAACCACT
GAAAGTTTAGATTTACTCACAAGACTAATAAAAAATGTGATTGAAAATCCAAATGAAGAC
AAGTTCAGATAGTTTAAGATGAACAATGCGAAAATTTAAGAGAAGTTGACTTAATTTAAG
AGTGGAAATGACTTGATTAAAATGCTAGGATTCCAAGAAATACTAGAATAATCCACAAAT
GAGCCAATATATTATATGAGTAATAATTTAAGCATGTCATTTATAAAAAATACAATGGAC
ATCGACCTCTTAAACGTTGACCCCGTTCAGGAAGAGAAATTGCACAAGCTGAAGAGACTC
GTTCAATCACCAAACTCCTACTTCATGGACGTTAAGTGCCCCCAGTGCTACAACATCACC
ACCATCTTCTCACACGCACAAACTGCAGTTGCCTGCAGCGGATGTGGTTTTGTACTCTGC
GCCCCCACTGGAGGAAAATGCAAGCTTAGTTTGGGAACTGCCTGGAGAAGAAAGGGAGAC
TGA


>Contig4448.0.g28(protein)
MGCCMSVQSTQSPQKLNFESQNMASSPIPQSNQQIIKVKRQLQESFKKQQIPLSQKLKDT
LQKINSKGQFPCRFVGLHFIHNYLMFVRERIIPEKNELLIFDLRDKQQINEFRILKSQQI
QPDQVVHNQETLSLFKQQIHFKYIFMIGESKDFDSASFTELMNQIIDLEMKPFCFYLHRL
KQELVEAEFPHLIIRGHEKRKLGYYPQIIVKCKDMGLEKSKNKFQILMANSQIIRAQQVL
EMQITKAIQIDDESSFSPGKKQEGLQGLLKERRISVNIVDIICDILKEFSQEKNNGSQAI
QMVKINANIKRNDEKSFKEKLIDQMKLLHVEQKKILAKTTESLDLLTRLIKNVIENPNED
KFRQFKMNNAKIQEKLTQFKSGNDLIKMLGFQEILEQSTNEPIYYMSNNLSMSFIKNTMD
IDLLNVDPVQEEKLHKLKRLVQSPNSYFMDVKCPQCYNITTIFSHAQTAVACSGCGFVLC
APTGGKCKLSLGTAWRRKGD