Identifiers and Description

Gene Model Identifier

Contig11703.0.g4

Standard Name

RPS27A

Aliases

Contig11703_0_g4

Description

Ribosomal protein S27a

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR167W5.000574419929632e-30RPS31 SGDID:S000004157, Chr XI
I from 498947-499405, Gen...
T. thermophilaTTHERM_006861500.000000000000001999258566166494Ribosomal protein S27a contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11703.0.g4(coding)
ATGCAAATCTTCGTTAAGACCCTCACCGGAGTCACCTTGACTTTCTAGGTTGAAGAATCT
TGTCTCGTCGCTGACTTGAAACAGCAAATCGCTGAAAAGGAAGGATTCGAAACTGAGGAG
CTTGTTCTCATCCACGGACTCTCAACTCTCGAGGATGATCAAACTCTCACAGTTTACGGT
ATCCAAGAAGAGGCAACCATCAACTCCGTTGTCGCTCTATGTGGTGGTAAGAAGAAGAGA
AAGAAGAAGATCTACACCAAACCCAAGAAGATCGCCCACAAGCACAAAAAGAGACCCAAG
GCTCTCCTCGAATACTTCAGCGTTGACAACACTGGAAAGATCTCAAAGCTCAAGATCGAG
TGCGAGAAGTGCCCAGCTGGTACCTATATGGCCGATCACCCAGATAGACACACCTGCGGT
AAATGCGGAAACATGTTCTACAAGTTGACCAAGGACGGAAAGAGAATGCCAATTCCCAAG
CAAAACAAGCCAACTATTGCCGCCAAGGCCGATGCTGCCCCAGCCAAGGGAGCCGCTGCC
AAGGGAAAGAAGAAGTGA


>Contig11703.0.g4(protein)
MQIFVKTLTGVTLTFQVEESCLVADLKQQIAEKEGFETEELVLIHGLSTLEDDQTLTVYG
IQEEATINSVVALCGGKKKRKKKIYTKPKKIAHKHKKRPKALLEYFSVDNTGKISKLKIE
CEKCPAGTYMADHPDRHTCGKCGNMFYKLTKDGKRMPIPKQNKPTIAAKADAAPAKGAAA
KGKKK