Identifiers and Description

Gene Model Identifier

Contig22691.0.g43

Standard Name

RPS26b

Aliases

Contig22691_0_g43

Description

Ribosomal protein S26e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01283 ) Ribosomal protein S26e
  • ( pfam13248 ) zinc-ribbon domain
  • ( pfam01194 ) RNA polymerases N / 8 kDa subunit
  • ( pfam05870 ) Phenolic acid decarboxylase (PAD)
  • ( pfam03604 ) DNA directed RNA polymerase, 7 kDa subunit
  • ( pfam11105 ) Arthropod cardioacceleratory peptide 2a
  • ( pfam07282 ) Putative transposase DNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004634909.99893167504554e-35Ribosomal protein S26e contain
ing protein
SGDYGL189C1.9991517704232713e-32RPS26A SGDID:S000003157, Chr V
II from 148588-148229, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22691.0.g43(coding)
ATGCCATCCAAGAGAAGAAACAACGGAAGAAACAAGAAGAACAAGGGTCACGCTGATACT
GTTAGATGCACTAACTGCGGTAGAGTCGTATCCAAGGACAAGGCCATCAAGCGTTTCCAG
TAGAGAAATATGGTGGATGCCTCATCAAAGAGAGATATCCAAGAAAACTATGCCTACGCT
CAAGCCGACTTCCAGATGCCCAAAATTTACGTGAAGCAAGCTTATTGCGTATCTTGTGCC
ATCCACGCTCGTATTGTTAGAAATAGAAGAGTCGAGGACAGAAGAAACAGATATACCACC
AAGCTTAGACAGCACGTGAGACCAGAAGCCCAAACCGGTAACGCTTCACTCCCTCTCTCC
CAACTTCCAAGAATCTGA


>Contig22691.0.g43(protein)
MPSKRRNNGRNKKNKGHADTVRCTNCGRVVSKDKAIKRFQQRNMVDASSKRDIQENYAYA
QADFQMPKIYVKQAYCVSCAIHARIVRNRRVEDRRNRYTTKLRQHVRPEAQTGNASLPLS
QLPRI