Identifiers and Description

Gene Model Identifier

Contig22576.0.g76

Standard Name

RPS24

Aliases

Contig22576_0_g76

Description

Ribosomal protein S24e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIL069C9.996273942859018e-26RPS24B SGDID:S000001331, Chr I
X from 231957-231553,2323...
T. thermophilaTTHERM_004676602.000769134519826e-18Ribosomal protein S24e contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22576.0.g76(coding)
ATGTCAGACCAGAAGTTTATCCTTTACGCTCGTAAATTCTTGAAGAACCCTCTCTTAGGA
AGAAGACAATGCGTTATTGAGTTAGTTCACCCAGAGATGGCTAACGTTCCTAAAGCTCAG
ATCAAGACCAAGTTGTCTGCAATTCTCAAGAGCAAGGAGGAGCAAATTGCTATTTTCGGA
CTTAAGACCAAGTTCGGAGGTGGTAGAACCACTGGCTTCGCTGCTATCTATGATTCAGTA
GATTTAAGAAAGAAGTACGACAGCAAGAAAATGCTTAGAAGAGATGGTTACCTCGTAAGA
CCAAAGGGCAGCAGAAAGCAAAGAAAGGAAATCAAGGGCAGAGTCTTGAAAGTCAGAGGT
ATCGCCAAGGCAAAGGCCGCCACTTCTGGTGGAAAGAAGAAGTGA


>Contig22576.0.g76(protein)
MSDQKFILYARKFLKNPLLGRRQCVIELVHPEMANVPKAQIKTKLSAILKSKEEQIAIFG
LKTKFGGGRTTGFAAIYDSVDLRKKYDSKKMLRRDGYLVRPKGSRKQRKEIKGRVLKVRG
IAKAKAATSGGKKK