Identifiers and Description

Gene Model Identifier

Contig12890.0.g103

Standard Name

RPS23

Aliases

Contig12890_0_g103

Description

Ribosomal protein S12

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR132W4.997966074691795e-65RPS23B SGDID:S000006336, Chr X
VI from 794965-795029,795...
T. thermophilaTTHERM_004340406.999654975490295e-63ribosomal protein S25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12890.0.g103(coding)
ATGGGAAGTGGAAAGCCTAGAGGTATTAACGCCGGACGTAAACTTAAGACTCACAGAAGA
ATCAACTTGTGGGCTGATAAGCAATACAACAAGTCTCACTCTACATCTAAATGGAGAAAG
CCATTCGCCGGTTCATCTCACGCCGCAGGTATCGTCGTTGAAAAGGTCGCAGTCGAAGCT
AAGCAACCTAACTCCGCCGTCAGAAAGTGTGTCAGAGTGCAACTCAAGAAAAACAACAAG
AGAATCACTGCCTTCGTACCTAAGGATGGTGGTATGAGTTTCATTGATGAGAACGATGAA
GTGCTCGTTGCTGGTTTCGGTAGATCTGGTCACGCCGTCGGAGATTTGCCAGGAGTCAGA
TTCAGAATTGTCAAGGTCGCTGGAGTCTCACTCTACGCTCTCTGGCTCAGAAAGAAGGAA
AAGCCAATCAAGTGA


>Contig12890.0.g103(protein)
MGSGKPRGINAGRKLKTHRRINLWADKQYNKSHSTSKWRKPFAGSSHAAGIVVEKVAVEA
KQPNSAVRKCVRVQLKKNNKRITAFVPKDGGMSFIDENDEVLVAGFGRSGHAVGDLPGVR
FRIVKVAGVSLYALWLRKKEKPIK