Identifiers and Description

Gene Model Identifier

Contig144.0.g19

Standard Name

RPS21

Aliases

Contig144_0_g19

Description

Ribosomal protein S21e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008379209.997093137033517e-262hypothetical protein
SGDYKR057W3.99801309251602e-27RPS21A SGDID:S000001765, Chr X
I from 551657-551680,5520...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig144.0.g19(coding)
ATGTAAAACGACGAGAAAAAGATTGTAGATCTCTACATCCCAAGAAAATGCTCTGCCACC
AACAGACTCATCACTGCCAAGGATGCTGCCTCCGTTCAAATCGATATTGCCGAGGTTGAC
GAGCACGGAAAGATCACTGGAAAGAAGAAGACTCTTGCTTTAGCTGGTTTCATGAGATCA
AGAGGAGAAGCCGACGCTTGCCTCAACAGACTCCTCGCTGATTTTGACCTCATCAGCTTC
AGAAGATGA


>Contig144.0.g19(protein)
MQNDEKKIVDLYIPRKCSATNRLITAKDAASVQIDIAEVDEHGKITGKKKTLALAGFMRS
RGEADACLNRLLADFDLISFRR