Identifiers and Description

Gene Model Identifier

Contig381.1.g57

Standard Name

RPS20

Aliases

Contig381_1_g57

Description

Ribosomal protein S10p/S20e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00338 ) Ribosomal protein S10p/S20e
  • ( pfam10073 ) Uncharacterized protein conserved in bacteria (DUF2312)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009927605.001052752541194e-37ribosomal protein S10 containi
ng protein
SGDYHL015W4.000054831110256e-33RPS20 SGDID:S000001007, Chr VI
II from 75412-75777, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig381.1.g57(coding)
ATGACCCTTAGAAGCAAAGAAATTAAGGCACTTGAGGCTGCATGCGCTGAGATCGTTGCT
AGAGCCAAGAATCAAGGCTACGAAACCAAAGGACCAGTTCGCATCCCAACTAAGATCCTT
AAGATCACCACCCGTAAGTCTCCTTGCGGTGAGGGTTCAAAGACTTGGGACAGATTCGAG
ATGAGAATCCACAAGAGAGTCGTCGATATTCACTGCCCATCAAGCGTTGTCAAGGAAATC
ACTAATTTCAGAATCGACCCAGGCGTAGATGTCAACCTTATTGTCTGGAAGCAATGA


>Contig381.1.g57(protein)
MTLRSKEIKALEAACAEIVARAKNQGYETKGPVRIPTKILKITTRKSPCGEGSKTWDRFE
MRIHKRVVDIHCPSSVVKEITNFRIDPGVDVNLIVWKQ