Identifiers and Description

Gene Model Identifier

Contig21017.0.g17

Standard Name

RPS2

Aliases

Contig21017_0_g17

Description

Ribosomal protein S5, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00333 ) Ribosomal protein S5, N-terminal domain
  • ( pfam03719 ) Ribosomal protein S5, C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001937405.002432061182517e-99ribosomal protein S5 containin
g protein
SGDYGL123W6.002904662242373e-91RPS2 SGDID:S000003091, Chr VII
from 277617-278381, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21017.0.g17(coding)
ATGGAAGAAGGCGCAGCAGCAGTACCAACTCAAGTACCAACTGAGGGACAAACTGAAGAA
AGAAGAGGCGGAAGAGGTGGCTTCGGAAGAGGCGGAGCTAGAGGTGGCAGAGGTGGCCCC
AGAGGTGGTGCCAGAGGTGGCCCAAGAGGAGACGACAAGGATTGGGTTCCCCTAACCAAG
CTCGGAAGACTCGTTAAGTACAACATGATCAAGTCACTCGAGGAAATCTACACTCACTCT
ATTCCCATCAAGGAATCCCAAATCGTTGATGAGCTCCTTTCCAGATCAAAGAAAGAACTC
TCCGATGAGGTCATGAAGATCATTACCGTCCAAAAGCAAACCAAGGCCGGTTAAAGAACC
AGATTCAAGGCCGTTGTTGCCGTCGGTGATCTCGATGGTCACGTCGGTCTCGGTGTTAAG
GTTGCTAAGGAAGTCCAAATTGCCATTAAGGGAGCCTTAGTTGCTGCCAAGCTCTCACTC
ATCCCAGTCAGAAGAGGTTATTGGGGTAACAAGATCGGTGGTGTCCACACTGTCCCAGTT
AAAGTTACTGGTAAGTGCGGTTCAGTCAGAATTAGACTCATCCCAGCCCCAAGAGGAACC
GGTATCGTCGGAGCACCAACCTCAAAGAAGCTTTTGCAATTCGCAGGTATTGAAGATTGC
TTCACTGCTTCAACTGGTTCAACCAAGACTCTTGAGAACTTCATCAAGGCTACTTTTGAT
GCTCTCCAAAACACTTACGGTTTCCTTACCCCAGATCTCTGGCCAAAGACCGATTTCCTC
CCATCTCCATTCATCATCTATGCTGATTTCCTTAAGCAACAACAAGAGAAGAGAGCTGGT
CCAAGAGGCGAAAGAGACGAAAGAGGTGGACGCGGAAGAGGCAGAGGTGGCCGTGGAAGA
GGTGATGCCAGAGGTGGCAGAGGCTTCGGAAGAGGCGGCAGAGGTGGCAGAGGAGGCCCA
AGAGCCGAAGGTGCCCAAGAAGGTGGTGATGCTCAACCATCAGGCGATGCCCAAGAATGA


>Contig21017.0.g17(protein)
MEEGAAAVPTQVPTEGQTEERRGGRGGFGRGGARGGRGGPRGGARGGPRGDDKDWVPLTK
LGRLVKYNMIKSLEEIYTHSIPIKESQIVDELLSRSKKELSDEVMKIITVQKQTKAGQRT
RFKAVVAVGDLDGHVGLGVKVAKEVQIAIKGALVAAKLSLIPVRRGYWGNKIGGVHTVPV
KVTGKCGSVRIRLIPAPRGTGIVGAPTSKKLLQFAGIEDCFTASTGSTKTLENFIKATFD
ALQNTYGFLTPDLWPKTDFLPSPFIIYADFLKQQQEKRAGPRGERDERGGRGRGRGGRGR
GDARGGRGFGRGGRGGRGGPRAEGAQEGGDAQPSGDAQE