Identifiers and Description

Gene Model Identifier

Contig11050.0.g68

Standard Name

RPS19

Aliases

Contig11050_0_g68

Description

Ribosomal protein S19e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008236708.00089003463867e-30Ribosomal protein S19e contain
ing protein
SGDYNL302C9.996273942859018e-26RPS19B SGDID:S000005246, Chr X
IV from 62372-61958,62943...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11050.0.g68(coding)
ATGGATATCTAATTGGCAGTTATTAACTCAAGCAACGCCGTGGGAGTGAAAGACGTACCA
GCAAAGGAGTTTATCGAAGCCTTCTCCAAGCATCTCAAGAAGAGCAACAAGTTCAAGATC
CCCGACTGGGCAACTTATGTTAAGACTGGTTGCTTCAAGGAGCTCGCCCCATATGATTCA
GACTGGCTTTACGTGAGAGCTGCATCAGTTGCCTACCAATTGTTCATTAGAGGCAAGGTT
GGTATCTCAGCCTTGAGAACTCACTACGGTGGAAAGCAAAGATGGGGAACCTGCCCACCC
CACCAAAGACAATCAAGTGGAAAGATCATCAGATACTGCTTAAAGCAACTCGAAGAGCAA
GGACTCGTTGGTCAAGTTAAGTACCAGTCAGAAGATGGAACTGAGCAAACCGCCGGCAAG
ACCCTCACCGACAAGGGCCAAACTGACATGAACAGAATCGCTGGACAACTCATTAAGGAC
AAGAAGAAGCTCAAGAAATGA


>Contig11050.0.g68(protein)
MDIQLAVINSSNAVGVKDVPAKEFIEAFSKHLKKSNKFKIPDWATYVKTGCFKELAPYDS
DWLYVRAASVAYQLFIRGKVGISALRTHYGGKQRWGTCPPHQRQSSGKIIRYCLKQLEEQ
GLVGQVKYQSEDGTEQTAGKTLTDKGQTDMNRIAGQLIKDKKKLKK