Identifiers and Description

Gene Model Identifier

Contig19625.0.g104

Standard Name

RPS18

Aliases

Contig19625_0_g104

Description

Ribosomal protein S13/S18

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYML026C3.000458792073453e-56RPS18B SGDID:S000004488, Chr X
III from 223380-222987,22...
T. thermophilaTTHERM_001311104.999934616708877e-52ribosomal protein S13p/S18e co
ntaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19625.0.g104(coding)
ATGTCTTCAATCGTGTTGGCTAAGGCAAACGAGTTCACTCACATTTTGAGAATCCAAAAC
ACAAACGTCGAGGGTAAACGCAAGGTCATGTTCGCACTAAGAGTCATTAAGGGTGTTGGT
AGAAGATTCTCCAACCTTATCCTCAAGATCGCCTAAATCGACCTTAACAAGAGAGCTGGT
GAATTGACCGAGCAAGAGATTGAAAAGGTCAACGATATCCTCGCTAAGCCCACTGACTAT
AACATTCCCAAATGGTTCTTGAACAGACAAAGAGATATCAGAGACGGCAACTGGACCCAA
TTGATCTCCAACGCTTTGGACACCAAGCTCAGAGAGGATTTGGAAAGAATGAAGAAGATC
AGATGTAACAGAGGTCTTAGACACTTCTTGGGCCACAAGGTCAGAGGTCAAAAGACAAAG
TCAACTGGTAGAACCGGAAGAACCCTCGGAGTCACCAAGAAGAAGTGA


>Contig19625.0.g104(protein)
MSSIVLAKANEFTHILRIQNTNVEGKRKVMFALRVIKGVGRRFSNLILKIAQIDLNKRAG
ELTEQEIEKVNDILAKPTDYNIPKWFLNRQRDIRDGNWTQLISNALDTKLREDLERMKKI
RCNRGLRHFLGHKVRGQKTKSTGRTGRTLGVTKKK