Identifiers and Description

Gene Model Identifier

Contig1018.1.g95

Standard Name

RPS17

Aliases

Contig1018_1_g95

Description

Ribosomal S17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007628902.000214949834694e-50Ribosomal S17 family protein
SGDYDR447C1.9990449803848145e-49RPS17B SGDID:S000002855, Chr I
V from 1355236-1354829,13...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1018.1.g95(coding)
ATGGGAAGAGTTAGAACTAAGACTGTTAAGAGAGCTTCTAAGGCCATCATTGAGAGATAC
TACGGAAAATTGACCAATGACTTCCACACTAACAAGCGTATCATTGATGATATTGCCGTC
GTCCAATCCAAGAGATTAAGAAACAAGATTGCTGGTTTCACCACCCACATGATGAAGAGA
ATCCAAAAGGGACCAGTAAAGGGCATCTCACTTAAGCTCCAAGAAGAGGAAAGAGAGAGA
AAGATGGACTTTATTCCAGAGAGATCAGAGCTTCAAGTAGAGAACTTGGAAATCAAGGAC
AGCGTCGTCAGACAATTGGTCAAGGATCTCGGTCTTAGAAAGCTCATTCCAGGCAGACAA
AAGAAAGAATGA


>Contig1018.1.g95(protein)
MGRVRTKTVKRASKAIIERYYGKLTNDFHTNKRIIDDIAVVQSKRLRNKIAGFTTHMMKR
IQKGPVKGISLKLQEEERERKMDFIPERSELQVENLEIKDSVVRQLVKDLGLRKLIPGRQ
KKE