Identifiers and Description

Gene Model Identifier

Contig21935.0.g16

Standard Name

RPS16

Aliases

Contig21935_0_g16

Description

Ribosomal protein S9/S16

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR143W2.9995010303521745e-64RPS16A SGDID:S000004751, Chr X
III from 551928-551951,55...
T. thermophilaTTHERM_007063004.001202823045957e-54ribosomal protein S9 containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21935.0.g16(coding)
ATGAGTGAAATTAAGTCAGTACAAACTTTCGGCAGAAAGAAGAACGCCACCGCAGTCGCT
TACTGCACCAACGGAACTGGACATATCAGAGTCAACGGTAAGGCCCTAAACCTCGTTGAA
CCAGAGTCTCTCAGACTCAAGCTCTACGAGCCAATTTTCTTGGTTGGAGGTAACAGGTTC
AAGGACCTCAATATGAGAGTGCGCGTTAGAGGTGGTGGTCCTTCAAACTAAGTCTTCGCC
ATCAGACAAGCCATCTCCAAGGCTCTCCTCGCTTACTACCAAAAATATCACGATGAGCAG
TCAAGAAGAGAACTTAAGGACATATTCCTTCAATACGACAAGACCCTCCTCGTTACCGAC
CCAAGAAGATGCGAGCCAAAGAAGTTCGGTGGTAAAGGTGCCAGAGCCAGATTCCAGAAG
TCTTACAGATGA


>Contig21935.0.g16(protein)
MSEIKSVQTFGRKKNATAVAYCTNGTGHIRVNGKALNLVEPESLRLKLYEPIFLVGGNRF
KDLNMRVRVRGGGPSNQVFAIRQAISKALLAYYQKYHDEQSRRELKDIFLQYDKTLLVTD
PRRCEPKKFGGKGARARFQKSYR