Identifiers and Description

Gene Model Identifier

Contig12805.0.g106

Standard Name

RPS15A

Aliases

Contig12805_0_g106

Description

Ribosomal protein S8

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR367W2.0004485223439647e-69RPS22B SGDID:S000004359, Chr X
II from 856442-856574,857...
T. thermophilaTTHERM_004540808.998258374026963e-65ribosomal protein S8 containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12805.0.g106(coding)
ATGGTCAGAATGAGTGTTATTGCTGATAGCTTAAAGTCAATTATTAACGCAGAAAAAGCA
GGAAAGAGACAAGTCCTCCTCAGACCCACTTCCAAGGTTCTCGTTAAGTTCCTCAGAGTT
ATGTAAAAGCACGGTTACATCGGTGAATTCGAGATCGTTGACGACAAGAGAAACGGAAAG
ATCATCGTTGAGTTGAACGGAAGATTGAACAAGTGCGGAGTCATCTCCCCCAGATACGAC
CTCAAACTCAAGAACTTCGAGAAGTTCATCTACAACATCCTCCCCTCCAGACAGTTCGGA
TACGTCATTCTCACCACTACCTACGGTATCATGGACCACGAAGAAGCCAAGAGAAAGCAC
ATCGGTGGCAAGGTCCTCGGCTACTTCTACTGA


>Contig12805.0.g106(protein)
MVRMSVIADSLKSIINAEKAGKRQVLLRPTSKVLVKFLRVMQKHGYIGEFEIVDDKRNGK
IIVELNGRLNKCGVISPRYDLKLKNFEKFIYNILPSRQFGYVILTTTYGIMDHEEAKRKH
IGGKVLGYFY