Identifiers and Description

Gene Model Identifier

Contig7529.0.g65

Standard Name

RPS15

Aliases

Contig7529_0_g65

Description

Ribosomal protein S19

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOL040C3.9998411574835458e-50RPS15 SGDID:S000005400, Chr XV
from 253577-253149, Geno...
T. thermophilaTTHERM_002663908.997017754360629e-34hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7529.0.g65(coding)
ATGGCAAGCAAAGGAGCAGAACAAATTGATACCAGCGCTTAGAATCAACAAAAGAAGAAG
GCTTTCAAGAAGAGTACTTACAGAGGCATTGAACTCGAAAAGTTGCTTGAGTTAAGCATG
GACCAACTCGTCAAGCTCTTCAGAGCCAGACAAAGAAGAAGATTCGCTCACGGTATTCAC
CAGAGATACGATAGACTCCTCAAAAAGCTCAAGAAGGCCAAGAAGGAAACCCCATACGGT
GAAAAGCCAAAGGGAGTCAAGACTCATCTCAGAAACTGTATCGTTGTTCCTGAAATGGTA
GGCTCAGTCGTGGAAGTCTACAGTGGCAAGTACTGGAACAGTATTGAAGTGAAACCCGAT
ATGGTTGGTCACTACTTGGGAGAGTTCTCACTCACCTACAAGGCTGTCAAGCACGGTAAA
GTCGGAGTCGGTGCTACCAGATCATCAAAGTTCACTTCCCTTAAATGA


>Contig7529.0.g65(protein)
MASKGAEQIDTSAQNQQKKKAFKKSTYRGIELEKLLELSMDQLVKLFRARQRRRFAHGIH
QRYDRLLKKLKKAKKETPYGEKPKGVKTHLRNCIVVPEMVGSVVEVYSGKYWNSIEVKPD
MVGHYLGEFSLTYKAVKHGKVGVGATRSSKFTSLK