Identifiers and Description

Gene Model Identifier

Contig5219.0.1.g44

Standard Name

RPS13

Aliases

Contig5219_0_1_g44

Description

Ribosomal S13/S15 N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR064W2.000299424410363e-74RPS13 SGDID:S000002471, Chr IV
from 579458-579478,58001...
T. thermophilaTTHERM_007733304.997966074691795e-65ribosomal protein S15 containi
ng protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5219.0.1.g44(coding)
ATGGGCAGAATGCATTCAAACGGCAAGGGTATTGCTCGCAGATGTCTTCCTTACAGAAGA
ACTCCTCCTAGCTGGGTTCAAATCTCTACTGGCGAATTGGTGGAACAGATTGTTAAATTG
GCCAAGAAGGGTACCTCTCCCTCTCAAATCGGTGTCATTCTTAGAGACAACTACGGTATC
CCCCAAGTCAAAGGTGTCACTGGCAATAAGATCCTCAGAATCTTGAAGAAGAACGGATTA
GCTCCCACACTCCCAGAAGACCTCTACCACTTGATTAAGAAGGCCGTCAACGTCAGAAAG
CATTTGGAGAGAAACAGAAAGGATACAGACGGAAAGTTCAGACTCATTCTCGTCGAGAGC
AGAATCCACAGACTCGCTCGTTACTACAGAAGAACCAAGCAGCTCCCACCCACATGGAAG
TACGAGTCAAAGAAGGCTGATTCACTAGTTGCATGA


>Contig5219.0.1.g44(protein)
MGRMHSNGKGIARRCLPYRRTPPSWVQISTGELVEQIVKLAKKGTSPSQIGVILRDNYGI
PQVKGVTGNKILRILKKNGLAPTLPEDLYHLIKKAVNVRKHLERNRKDTDGKFRLILVES
RIHRLARYYRRTKQLPPTWKYESKKADSLVA