Identifiers and Description

Gene Model Identifier

Contig21441.0.g88

Standard Name

RPS12

Aliases

Contig21441_0_g88

Description

Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01248 ) Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
  • ( pfam08032 ) RNA 2'-O ribose methyltransferase substrate binding
  • ( pfam01797 ) Transposase IS200 like
  • ( pfam04514 ) Bluetongue virus non-structural protein NS2
  • ( pfam04885 ) Stigma-specific protein, Stig1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR369C3.0002687256732656e-20RPS12 SGDID:S000005896, Chr XV
from 1028625-1028194, Ge...
T. thermophilaTTHERM_001610601.9999391735788327e-19Ribosomal protein L7Ae contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21441.0.g88(coding)
ATGGTTTGCACTATGAATATTTATCCAGAGGAACCACATAAAATAAGCTCAACTAAGGTC
TTTGACGAATCATCTAATTAATAATAAGAAGAAGATGGAATCGTAACAGATAAAGCAATC
AAAATTGCAGAAAAGATATGTTAAAAAATTGGATTGAAGCAGCTATTGTTCAGCTTTAAT
GTTTCTTAAAATCTCTGTGAATTGATGAATCAAGATATGAAGCTCAGCCTAATGCTTGAG
AAGAGACTTAGTGATTTAATTAAGGAATAAATCGAAACCGAGCCAGTCCAAGTTGAAGAG
GAGAAAGCCGACAACATCCACACTGCCACCAAGGTTGTTATTAAGAAGTCTTTGGCCAAC
AATGGTCTTGTGAAAGGATTGAACGAAGTTTGCAAGGCACTTGACCGCAAAGAAGCCCTT
CTTGCCGTCCTTGCTGAAGATTGTGAAGACGCTAAATACAAGAAACTTATTACCTCACTT
TGCAAGGCTAACAACATTCCCTTGATCGAAGTTGAGAAGAGATCAGATCTCGGAGAATGG
CTCGGCCAATGCAAATACGACAAATCAGGAGTCGCCAGAAGAGTTAGAGGTGCTTCATCA
GTCGCCATCAAGGATTACGGTGAAGAGACCGAAGCCCTCAACTTCGTCCTCAACTACATT
AAGGAGAACCACCAATGA


>Contig21441.0.g88(protein)
MVCTMNIYPEEPHKISSTKVFDESSNQQQEEDGIVTDKAIKIAEKICQKIGLKQLLFSFN
VSQNLCELMNQDMKLSLMLEKRLSDLIKEQIETEPVQVEEEKADNIHTATKVVIKKSLAN
NGLVKGLNEVCKALDRKEALLAVLAEDCEDAKYKKLITSLCKANNIPLIEVEKRSDLGEW
LGQCKYDKSGVARRVRGASSVAIKDYGEETEALNFVLNYIKENHQ