Identifiers and Description

Gene Model Identifier

Contig22520.0.g95

Standard Name

RPS11

Aliases

Contig22520_0_g95

Description

Ribosomal protein S17

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011097706.997568408582301e-83ribosomal protein S17 containi
ng protein
SGDYDR025W3.0012565309061457e-65RPS11A SGDID:S000002432, Chr I
V from 491515-491559,4918...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22520.0.g95(coding)
ATGGCAGATATTCAAACTGAGAGAGCTTTCCAAAAGCAAACAGGTGTGTTCCTTAACTCC
AAAAAACTCTTGGCAAAGAAGACCACCGCCGGTGTCAGATACTTCAAGAAGATCGGTCTT
GGTTTCAAGACCCCAACTGAAGCCATTGAAGGTCACTACGTCGACAAGAAATGCCCATTC
ACCTCCACTGTTTCAATCAGAGGCAGAATCTTCAAGGGCGTCGTGCTTTCAACCAAGATG
AAGAGAACCATCATCATCAGAAGAGATTACCTCCACTACGTCAAGAAGTACACCAGATTT
GAGAAGAGACATAACAACTTCTCCGTACATTGCTCACCCGCTTTCAGAGTCAGAGAAGGT
GATGTTGTTACCGTTGGACAGTGCAGACCACTCTCAAAGACCGTGAGATTCAATGTTCTC
AGAGTTGAAGCCAAGAGAATCGAAGGTAACGTTAGAAAGCAATTCGTTCTCTTCTGA


>Contig22520.0.g95(protein)
MADIQTERAFQKQTGVFLNSKKLLAKKTTAGVRYFKKIGLGFKTPTEAIEGHYVDKKCPF
TSTVSIRGRIFKGVVLSTKMKRTIIIRRDYLHYVKKYTRFEKRHNNFSVHCSPAFRVREG
DVVTVGQCRPLSKTVRFNVLRVEAKRIEGNVRKQFVLF