Identifiers and Description

Gene Model Identifier

Contig15938.0.g43

Standard Name

RPS10

Aliases

Contig15938_0_g43

Description

Plectin/S10 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR293W1.999790113608142e-24RPS10A SGDID:S000005819, Chr X
V from 867098-867149,8675...
T. thermophilaTTHERM_011285603.9992896861436003e-19Plectin/S10 domain containing
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15938.0.g43(coding)
ATGGTTTTAGTGTCAAAGGAAAACAAAAGAAAGATCTACGAGTACTTGTTGGCTGAAGGT
GTCCTTGTCGTCAAGAAGGATTCTTACCTACCCAAGCATCAAAACTTGCAAGATGTGCCC
AACCTTTAAGTAATGATGGTCGTGAAGTCACTCAAGTCAAAGGGACTTGTCCAAGATGTC
TTCTGCTGGTAATGGGCTTACTACACAATCACTAACAAGGGTGTTCAATTCCTCGTCAAG
GAACTTTCACTCCCAAGCGACATCGTTCCAGCCACCTTCAAGAAGAAGAGAACCACCGCT
GCCCCAAAGGCCAAGGGTGAAGACGATGATGAGAAGCCAACCAGAGCCACCGAAGAGGGC
GCCAGACCAACTGGACTCGGAAGAGGTCAAAGATGA


>Contig15938.0.g43(protein)
MVLVSKENKRKIYEYLLAEGVLVVKKDSYLPKHQNLQDVPNLQVMMVVKSLKSKGLVQDV
FCWQWAYYTITNKGVQFLVKELSLPSDIVPATFKKKRTTAAPKAKGEDDDEKPTRATEEG
ARPTGLGRGQR