Identifiers and Description

Gene Model Identifier

Contig14481.0.0.g41

Standard Name

RPP30

Aliases

Contig14481_0_0_g41

Description

RNase P subunit p30

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006900800.000000000004997916451710233RNase P subunit p30 family pro
tein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14481.0.0.g41(coding)
ATGGCATTAGCAAGCATTAATGGTAATCAAAATAATTTTATTCATGCATATATTTTAGAC
AACTATTCGTATATTGTGTACAATTTCATAAAAAATGGTGGCTAACTCACAGAAAAAGAT
AATTGTCCATTCAAAGGATTTGACTTGAAGAAACTATGGAATGAGAGTGAATAGAGAGGT
CTTCCTAAATTTTAAAACCCTGTAAAACCTAACTTCAAGAATATCAAGTAATACACTAGA
TTAACTATTATTTGCGATGACCCTAAAGTTGTTCATTAAATCATCAGAGGCATCTAATTT
GAGATTTGCTATGGATCATTGTGCTTTGAAGGATCCCAAGCAAATAGAAAGCAGTTTTTG
TAAAATTGCATGCAACTTGCCAAAGTTACTAAAGGGAAGAATATCATTTTGAGTAGTGAA
GTGACAAACAGCATTTATCAAAGAACTCCGTTAGATTGCATATAAATGGCTTTAATGTTT
GGAATCCCATAGAGAGAAGCATTGCAAGTGATGAGTAAAAATTCTTAAATGGCATTCAAG
CATGCTCATATGAGAAAAACTTACAAGGGTGTGGCAGAACTCATTATAAAATAGGGTGAG
GAAGAAGAAGAGGAAAAAATGCAGGATTGA


>Contig14481.0.0.g41(protein)
MALASINGNQNNFIHAYILDNYSYIVYNFIKNGGQLTEKDNCPFKGFDLKKLWNESEQRG
LPKFQNPVKPNFKNIKQYTRLTIICDDPKVVHQIIRGIQFEICYGSLCFEGSQANRKQFL
QNCMQLAKVTKGKNIILSSEVTNSIYQRTPLDCIQMALMFGIPQREALQVMSKNSQMAFK
HAHMRKTYKGVAELIIKQGEEEEEEKMQD