Identifiers and Description

Gene Model Identifier

Contig12052.0.g100

Standard Name

RPP25c

Aliases

Contig12052_0_g100

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000462500.0000000400154582995175hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12052.0.g100(coding)
ATGTCTGAATCTTACGAAAAGGTGAAACGTGATTAGGACAAGCTTCCTGATAACGAAATT
AGAGTCAGAGGAGATGTTAGAATTGGCAGATACCTCCGCAGAGCCAACGACCTCTTGACT
GGCAAGGTTGAGGGTCAAGACTCAGTTGTCATTAAGGGTATGGCTAAGGCAATGTAAAGC
GCAGTGGCACTTGCTGAATTGATTAAACATAGAGTCAAGGGAATACATTCATAAACTGAA
ATTGAGGTTTCTACTTTGATTGATGAATTTGAGCCATTGTATGAGGGACTTGATGTACTC
AAGTTTGAGAGATAAGTCACCATGATGGTCATCACCTTGACAAAAAATCCAAAGGACACA
ACTCACTACGGTTATCAAGAGCCAATCCCTGAAAGTGAAGTTTCTGCATATGAAGAGAGA
CAACCAGGTGAAGGTAGACCAGAGAAATAATACAGAGCAAGAAGCAGTTCAAGAGGACCC
ACTGGAGACAGAGGTGACAGAAGTGACAGAGATGACAGAAGTGAAAGAGGCAACAGAGGC
AGCAGAGGCGGCAGAGGCAACAGAGGCAACAGAGGCTTTAGAGGTGGAAGAGGAGGCTTC
CGTGGTGGTGAAAGAGATGCTCAAAGAGGTGGCTAAAGAGGAGGCTACAGATCCAGAGTT
GAAGGTGGTGATGACAGAAGAGAAGGTGGAGTTGCTAGTTATGGAGAAAGAAGACCACAA
CAAAATAGAGATAATGGATATGGTGGTAACAGAAGACCTTATGACAACCAAAGAAGAAGT
TATGGCGAAGACACTAGATCTTATGGTGGAGAGGGTCAAAGAAGATACTAAGGTGATAAA
TACCAAGGTGAAGGTTAAAGAAGACCATATGGCGACGACCAAAGAAGATCATATGGCGAC
GACCAAAGAAGATCATATGGCGACGACTAAAGAAGACCATATGGTGACGACCAAAGAAGA
GAACAAAGACCAAAGTCAAACTACAGAGAACAGAGACAAGGTGCTGATGTAGATACCTAT
GATAGATCACCAAGAAGAGAAAATCAAGGTGGTGATAGAGATAGATTTAGAAACAGATCA
GGCCCTAGATAAGAAGGTACCTAAGATGAACCAAGAAGAGGCAGTTTCAGAGGTAACAGA
GGTGGTCAAAGAGGAGGCTACAGAGGTGAAAGAGGCGGCTATAGAGACTTTAGAGGTGAT
AGAGACACTCAAAGAGTTGGGAATTACAGAGGTGAAAATAGAGGTGGCCAAAGAGGTGGT
TATTCCAGAGACGAAGATAGATATTGA


>Contig12052.0.g100(protein)
MSESYEKVKRDQDKLPDNEIRVRGDVRIGRYLRRANDLLTGKVEGQDSVVIKGMAKAMQS
AVALAELIKHRVKGIHSQTEIEVSTLIDEFEPLYEGLDVLKFERQVTMMVITLTKNPKDT
THYGYQEPIPESEVSAYEERQPGEGRPEKQYRARSSSRGPTGDRGDRSDRDDRSERGNRG
SRGGRGNRGNRGFRGGRGGFRGGERDAQRGGQRGGYRSRVEGGDDRREGGVASYGERRPQ
QNRDNGYGGNRRPYDNQRRSYGEDTRSYGGEGQRRYQGDKYQGEGQRRPYGDDQRRSYGD
DQRRSYGDDQRRPYGDDQRREQRPKSNYREQRQGADVDTYDRSPRRENQGGDRDRFRNRS
GPRQEGTQDEPRRGSFRGNRGGQRGGYRGERGGYRDFRGDRDTQRVGNYRGENRGGQRGG
YSRDEDRY