Identifiers and Description

Gene Model Identifier

Contig15988.0.g66

Standard Name

RPP25b

Aliases

Contig15988_0_g66

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000462500.00000000007999955850159168hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15988.0.g66(coding)
ATGCAAGGATACAAGAAAGTCCAAAAGGAGACTACTAAGACTAACGACAACGAAATCAGA
GTGACAGCCAAAGGTCAAATCAAGAAGTACCTCGGTTACGCTTTGAGCGCTTTCAACAAG
AGAGAAATGGAATCCATTGAAATCCGTGGAACTGGAAACGCCATCGTAAAGGCGCTAATC
TTGATTGAATTGGTTAAAAGAAGAGTTGGCGATCTCCATCAACTCAACAACATCACAAGC
ACTGAGATCGTAGACGAATTCGAGCCAATCGTCGAAGGCCTTGAAAAGATTGAGCAAAGA
AGAAGAGTCACATGCTTGAACTGTGTTTTGTCAAAGACTCCAGTCGATACTGAACACATT
GGTTACTAAGCTCCAACTCCAAAGGAGGAATTCAAACCAAGAGAAGACGCCAAGGGTGGT
GATAGACAAGTCAAGCAAGGTGGTCCAAGAGGTGACAGACCAGAGAGAGGTGGTAGAAGA
CCTGCAAGACCAGTCAGATACAACGACTCTGACGAGCAACAAGTTCAACCAAGAAGAGAG
AATCAACCAAGAGGCGAAAACAGAGGCGGCTTCAGAGGTAACAGAGGAGGAGCCTTCAGA
GAGAGAGGTGAATTCAGAGCTGACAGAGATAGAAGAGACAACCGTGATTATCGCGACGAA
AACAGAAGACCACAACAACAAAGAAGAGGTGGTTCAAGAGACGATATGGAAGTGAGACCA
AGAAGAGGTGGCAGAGACGATATTGATTTCGGTGGTCAACCCCAAAGACAAGGTGGTGAT
AGACCTAACAGAGGTAGAGGCGGTGCTCCAAGAGGTGGCTTCAATGAAAGAGTTCACGAC
GATAACTTCAGAGGTGGATACAATGGTCCCCAAAGAGGTGGAAGATTCAACCAAGGTGGC
AGATTCAATCAAGATTATGATAGAGAATATGAAGAAGACAGAAGACCACAAAGAAGACCA
TTCAATGATAACTATGATGGTCCATAATAAAACCAAGTTAGAACTTACGATAGACCCCAA
AGAGAAATCAGAGAAGAAAGATTCGAGCCAAAGCCAATGAGAGAAAGAAACGACTTCGAA
GGTGCTCCAATTGATAGACCTTTGAGAGGAAGAGGCAGAGGTGACTTTGGTGGAGATAGA
CCATTCAGAGGTAGAGGTGGTGAGTTCGGTGCCGGTGAAAGACCATTCAGAGGAAGAGGT
GGCTACAACAGAGAAGAAGGTGCCCCTGGTGAAAGACCATACAGAGGAAGAGGCAGAGGT
GGCTTCAACGGTGGCGACAGAGAAGACTTCAATGGTGAAAGAGGTGGATTCCGTGGAGGT
GACAGAGGCGGCTTCAGAGGCGACAGAGGTGGTTTCAGAGGTGGCGACAGAGGTGGCTAT
AGAGGAGGCGACAGAGGTGGCTTCAGAGGAGGCGACAGAGGTGGTTTCCGTGGAGGTGAC
AGAGGCAGCTTCAGAGGAGGAGATAGATTCAACGAATGA


>Contig15988.0.g66(protein)
MQGYKKVQKETTKTNDNEIRVTAKGQIKKYLGYALSAFNKREMESIEIRGTGNAIVKALI
LIELVKRRVGDLHQLNNITSTEIVDEFEPIVEGLEKIEQRRRVTCLNCVLSKTPVDTEHI
GYQAPTPKEEFKPREDAKGGDRQVKQGGPRGDRPERGGRRPARPVRYNDSDEQQVQPRRE
NQPRGENRGGFRGNRGGAFRERGEFRADRDRRDNRDYRDENRRPQQQRRGGSRDDMEVRP
RRGGRDDIDFGGQPQRQGGDRPNRGRGGAPRGGFNERVHDDNFRGGYNGPQRGGRFNQGG
RFNQDYDREYEEDRRPQRRPFNDNYDGPQQNQVRTYDRPQREIREERFEPKPMRERNDFE
GAPIDRPLRGRGRGDFGGDRPFRGRGGEFGAGERPFRGRGGYNREEGAPGERPYRGRGRG
GFNGGDREDFNGERGGFRGGDRGGFRGDRGGFRGGDRGGYRGGDRGGFRGGDRGGFRGGD
RGSFRGGDRFNE