Identifiers and Description

Gene Model Identifier

Contig4739.0.g39

Standard Name

RPP25a

Aliases

Contig4739_0_g39

Description

Alba

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4739.0.g39(coding)
ATGGCTGATAAGTACCTTAGAGTCGATAAGGCTCAAGATAAACTCCCAGAAAATGAAATC
AGAGTTAAGAGAGGTCCAGGTATTGGAAGATACCTCAGAAGAGCCAACGAGCTCTTGACT
GGCAAGGTCCAAGGTCAAGACTCCGTTGTGATCAAGGGTGTTTCAAACGCCATGGAGAAC
GCTGTCAAGCTTGCTGAGCTCATTAAGCACAGAGTTAGACAACTCCATCAACACAACGAA
ATCTCAAATGTCACTATTGTTGATGAATACGAACCACTTGAAGAAGGTCTCGACCAACTA
AAGTTCGAAAGAAACGTCACCATGCTCACCATTACCTTGAGCAAGACCCCAGTTGACGAA
AAGCACGTTGGATATCAACTCCCCATTCCAGACAGCGAAGTCGTTGAATACAACGAAAGA
CCAGTTGGAGAAGGTCGCCCAGAAGGTGACAGACCAAGAGGCGGCAGAGGTGGCTTCAGA
GGAGGATTCAGAGGTGGATTCAGAGGCGGCAGAGGCGGCTCAAGAGGCGTTAGAGGCGGT
AGAGGCGGCTTCAGAGGTGGTGACAGAAGACCATACGATGAAAACAGACAACCAAGACAG
TATGATGGTGAGAGATAAGCCAGACCATACGACGCTGAGAGACCAAGAGGCAGAGGTGGA
TTCAGAGGAGAAAGAAGAGAAGGTGCTGAGAGAACCTACGACAGACCTCCCAGACAATAC
GATGGTGAGAGACAACCAAGACAATACGACGGTGAGAGACCAAGAGGCAGAGGTGGCTTC
AGAGGTGAGAGAAGAGAAGGAGATGATAACAGACAACCAAGAACCTACAATGATAGACCA
CCCAGACAATACGATGGCGAGAGACAACCAAGAACCTACAATGATAGACCACCCAGACAA
TACGATGGCGAGAGACAACCAAGAACCTACGACAATGAAAGACCAAGAGGTGGCAGAGGT
GGTGCTCCCAGAGGTAGTGCTAGAGGTGGTTATGCTCCATAATGA


>Contig4739.0.g39(protein)
MADKYLRVDKAQDKLPENEIRVKRGPGIGRYLRRANELLTGKVQGQDSVVIKGVSNAMEN
AVKLAELIKHRVRQLHQHNEISNVTIVDEYEPLEEGLDQLKFERNVTMLTITLSKTPVDE
KHVGYQLPIPDSEVVEYNERPVGEGRPEGDRPRGGRGGFRGGFRGGFRGGRGGSRGVRGG
RGGFRGGDRRPYDENRQPRQYDGERQARPYDAERPRGRGGFRGERREGAERTYDRPPRQY
DGERQPRQYDGERPRGRGGFRGERREGDDNRQPRTYNDRPPRQYDGERQPRTYNDRPPRQ
YDGERQPRTYDNERPRGGRGGAPRGSARGGYAPQ