Identifiers and Description

Gene Model Identifier

Contig18565.0.g94

Standard Name

RPLP2b

Aliases

Contig18565_0_g94

Description

60s Acidic ribosomal protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18565.0.g94(coding)
ATGCGATCATGCTCAGTAGATGGGGCCACTGCCAGCTTTATCCTTCTTTCCAAGAATGAA
TGTCTTGCAACGCTTGATGGGACAGAGTCTTCTTCTCTTGCAGACGGTGCACTCGAGCTT
GAGGGTAACCTTCTTTGTGGTCTTTGCCTTCTTTCTGAAGATGGGCTTGGTCTGCCCTCC
GAAACCTTTTTGCTTGGCATCATATCTTCTCTTACCCTGTGCGACAGTGGAAGCCTTACC
GGTCTTGTATTGAGAGACCTTGTGAATAGCGTGCTTGTTGCATTTACCGCAATATGTTCT
CTTCTGTTTGGGAGCGTGTACCTATAAAACATGATTAGACTTAGAGAGTGTGCTTTACCA
TTTATCTTATACTAATAATTAATATTAAATAACACTTGCGAACAACGTAAAAACGAGCCC
GCTGTCGCTGATGTCGAGAAAGTTCTCAAGGAAGCCGGTATCAAGGCCGAAGCTGAACAC
CTCGAGAGACTCGTCACCGCTCTCAAGGGCAAAACCTTCCACGAATTAGTTGCATCTGGC
AAATCAAAGATGAGCTCAATGGGAACCGTCGTTTCCGCCCCCGCTGCTGGTGCCACTCAA
GCCGCTGCCAAGGTTGAGGAAAAGCCAAAGGAAGAAGAAGCCGCTGATGTTGATATGGGA
GGTCTCTTCGGTGATGACTACTGA


>Contig18565.0.g94(protein)
MRSCSVDGATASFILLSKNECLATLDGTESSSLADGALELEGNLLCGLCLLSEDGLGLPS
ETFLLGIISSLTLCDSGSLTGLVLRDLVNSVLVAFTAICSLLFGSVYLQNMIRLRECALP
FILYQQLILNNTCEQRKNEPAVADVEKVLKEAGIKAEAEHLERLVTALKGKTFHELVASG
KSKMSSMGTVVSAPAAGATQAAAKVEEKPKEEEAADVDMGGLFGDDY