Identifiers and Description

Gene Model Identifier

Contig775.1.g56

Standard Name

RPLP2a

Aliases

Contig775_1_g56

Description

60s Acidic ribosomal protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR382W0.0000000006000548789370351RPP2B SGDID:S000002790, Chr IV
from 1239492-1239824, Ge...
T. thermophilaTTHERM_004749700.00001999556617974735760s Acidic ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig775.1.g56(coding)
ATGAAACATTTAGCCGCTTACTGTCTCCTCGTCCTCGCAGGCAAACAAAACCCAACTGCT
GATGATGTCTCAAAGCTCTTGAAGGAAGTCGGTGTTGCCCCAGTTAAGGAAGATCTCGAC
ACCATGATGAAGGCTCTCGCTGGAAAGAAATTACACGAATTGGTTAGAGACGGTTCCAAG
AAACTCGCCTCCGTTCCATCAGGTGGTGTTGCCGCTGCTCCAGCTCAAGCTGCTGGTCAA
GCTGCCGCCCCAGCCAAGGTTGAGGAAAAGAAAAAGGAAGAAGAGGCTGCTGATGTTGAT
ATGGGAGGACTCTTCGGTGACGACTACTGA


>Contig775.1.g56(protein)
MKHLAAYCLLVLAGKQNPTADDVSKLLKEVGVAPVKEDLDTMMKALAGKKLHELVRDGSK
KLASVPSGGVAAAPAQAAGQAAAPAKVEEKKKEEEAADVDMGGLFGDDY