Identifiers and Description

Gene Model Identifier

Contig22477.0.g98

Standard Name

RPLP1b

Aliases

Contig22477_0_g98

Description

60s Acidic ribosomal protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL081C0.000030009396760408108RPP1A SGDID:S000002239, Chr IV
from 310122-309802, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22477.0.g98(coding)
ATGGCATCTGTTGACGTTTCTCAACTCTCAAAGCAAGAACACGACGAGCTCTCATGCGCT
TACGCTGCTCTCCTCTTACACGATGATGGACTCGAAATCACCGTACGTAACAAACACTCC
CACACTCGCTCTTATTCATTTAGCTTTCTTCATTGCTGGTTATTAATAGCATTTGTTTTA
TAGGGTGAGAAGTTATCCAAGGTCTTGAAGGCAAGTGGAAATGAAGTTGAAGCTTACTGG
CCCGCTATGTTCGCCAAGGCTCTCCAAGGTCAAAATATTGAAGAACTTCTCTCCAACCTC
GCTTCAGCCCCAGTCGGTGGAGCCGCCGTCGCTGCAGTTGACGCCCCAGCTGCCAAGGTC
GAGAAAGTTGAGGAGAAAAAGGTTGAGGAAGCCGCCGATGTTGACATGGGTGGACTTTTC
GGAGACGACTATTGA


>Contig22477.0.g98(protein)
MASVDVSQLSKQEHDELSCAYAALLLHDDGLEITVRNKHSHTRSYSFSFLHCWLLIAFVL
QGEKLSKVLKASGNEVEAYWPAMFAKALQGQNIEELLSNLASAPVGGAAVAAVDAPAAKV
EKVEEKKVEEAADVDMGGLFGDDY