Identifiers and Description

Gene Model Identifier

Contig13463.0.g46

Standard Name

RPLP1a

Aliases

Contig13463_0_g46

Description

60s Acidic ribosomal protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL081C0.00000000009998509410508463RPP1A SGDID:S000002239, Chr IV
from 310122-309802, Geno...
T. thermophilaTTHERM_010053200.000400018404765923260s Acidic ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13463.0.g46(coding)
ATGGCAAGCGTTGACGTTTCTCAACTCTCAAAGCAAGAACATGACGAGCTCGTATGTGCT
TATTCAGCTCTTCTCTTACACGATGATGGTCTCGAAATCACCAGTGAGAAATTGGCTAAG
GTTATTAAGGCCAGCGGTAATGAAGTTGAAGCTTACTGGCCAGCAATGTTCGCCAAGGCA
CTTAAGGGACAAGATATAGAAGATTTATTATCTAACCTCGCTTCAGCCCCAGTCGGTGGT
GCCGCCGTTGCTGAGGTAGCAGCTACCGCTGTTGCCGCTCCAAAGGTCGAGGAGAAGAAA
GTCGAGGAAGCCGCCGATGTTGATATGGGTGGACTTTTCGGTGATGACTACTGA


>Contig13463.0.g46(protein)
MASVDVSQLSKQEHDELVCAYSALLLHDDGLEITSEKLAKVIKASGNEVEAYWPAMFAKA
LKGQDIEDLLSNLASAPVGGAAVAEVAATAVAAPKVEEKKVEEAADVDMGGLFGDDY