Identifiers and Description

Gene Model Identifier

Contig18067.0.g83

Standard Name

RPLP0

Aliases

Contig18067_0_g83

Description

Ribosomal protein L10

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR340W3.998564387823535e-58RPP0 SGDID:S000004332, Chr XII
from 805887-806825, Geno...
T. thermophilaTTHERM_003004302.0004062814618821e-5760s Acidic ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18067.0.g83(coding)
ATGGGACTGGGAGGATTGAAAAAGAAGTCTGAAAAGAGAATCAAGAAAGAAGAGTACTGG
TACAAGCTCCAAGACCTCGCTGGAGAATACAGCAAGGCTATTTTGGTCGATGTTGACAAT
GTAAGCAGCAAGCAAATCAACTAGATCAGACTCAAGTTGAGACCCCTTAATGCCAAGATG
ATCATGGGCAAGAACACCCTCATGAAGGCCGCTCTTAACCACAAGATGAAGAAGCCAGAA
GAAACTGATGTGGACTACGAAACCAGAAAGGACAGCTGGAAGGAATGCGACGAATTGGAC
AAGATCGTTACTTTGTTGAAGGGTAACACTGGAATCATCTTCTCCAATGGAGATCTTTCC
GATATCAAGAAGGTTCTTGATGACTAATCCAGAGAAGCCCCAGCTAAGGTCGGTGCTGTC
GCCCCAGATGATGTGTGGATTAGAGCCGGTTCAACTGGTCTCGACCCCAAGCAGACATCT
TTCTTCCAACAGTTGAGCATCTCAACCAAGATTGTCAAGACCCAAATTGATATCGTTGCT
GACAAGAAAATCATCACTTCAGGTCAAAAGATTGAGGCCACCCACGCCGCTCTTCTTGAT
AAGCTCAAGATCAGACCTTTCAGCTACAAGATGCACGTCAAGAAGGTCTACGAAGACGGT
ACAATCTTCAACCCCGATGTTCTCGATATTACTACTGAGGATATCTTGGCTAGATTCAGA
AAGACCATTGGAAACTTGGCTTCAATTTCTCTTGCCTCAGGATTCATCATCAAGCCAGCA
GTACCACATCTTCTCGCTAACGCATTCAAGAATTTGGCTGCTGTTACCTTCGACTCTGAC
TACTCATTCAAGCAAGCCGACAAGATGAAGGAAGCTGCCAAGAATGCCGTACATGTCGCT
CCAGTTGCTGGTGGTGCAAAAACCGCCGCTCCCGCTAAAGTTGAGGAGAAAGTTGTAGAG
GAGGCTGCTGATGTCGATATGGGAGGTCTCTTCGGAGATGACTACTGA


>Contig18067.0.g83(protein)
MGLGGLKKKSEKRIKKEEYWYKLQDLAGEYSKAILVDVDNVSSKQINQIRLKLRPLNAKM
IMGKNTLMKAALNHKMKKPEETDVDYETRKDSWKECDELDKIVTLLKGNTGIIFSNGDLS
DIKKVLDDQSREAPAKVGAVAPDDVWIRAGSTGLDPKQTSFFQQLSISTKIVKTQIDIVA
DKKIITSGQKIEATHAALLDKLKIRPFSYKMHVKKVYEDGTIFNPDVLDITTEDILARFR
KTIGNLASISLASGFIIKPAVPHLLANAFKNLAAVTFDSDYSFKQADKMKEAAKNAVHVA
PVAGGAKTAAPAKVEEKVVEEAADVDMGGLFGDDY