Identifiers and Description

Gene Model Identifier

Contig14534.0.g66

Standard Name

RPL9

Aliases

Contig14534_0_g66

Description

Ribosomal protein L6

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL067W5.997992534675281e-52RPL9B SGDID:S000005011, Chr XI
V from 499681-500256, Gen...
T. thermophilaTTHERM_011427305.999460549133178e-49ribosomal protein L6 containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14534.0.g66(coding)
ATGAGAACTATTGTTGTTGAAGAGTGGGTTCACATTCCAGAAGGAGTTACCTTGACAGTG
AAGACCAGATAAGTGAAGGTGAAGGGCCCCAAGGGTGAGATCACCAAGGACTTCAGACAC
ATGCCAGTCGAGATGGCAATTAAGAAGCAAGCAACTAAGAATAGAAAGGGTCTGTATCTC
AACATCAAGATGTGGTTCGGAGCTGCCAAGCAATCCTGTTCCGTCGCCACCCTCAAGTCA
CTCGTCCGCAACATGATCAGCGGTGTCACTGAAGGTTACAGATATAAGATGAGACTAGTA
CATGCTCATTTCCCCATCAACGTCGTGATTCCCAAGGATGGCAGATCCGTTGAGGTCAAG
AACTTCCTCGGTGGAAAGCAAGCCAAGAAAGTCGAGTTGCTCCCAGGCTGCACCGTCAGA
ATGAACCCAGACCTTAAGGACGAGCTCATCTTCGAAGGCATTGACAACCAACACGTCTCC
CTCGGCTGCGCCCAAATCTCCCAAGTCTGCAAAATCGGAGACAAGGATAACAGAAAGTTC
CTCGATGGTATCTACGTTTCAGAGAAGGGAAGACAATGA


>Contig14534.0.g66(protein)
MRTIVVEEWVHIPEGVTLTVKTRQVKVKGPKGEITKDFRHMPVEMAIKKQATKNRKGLYL
NIKMWFGAAKQSCSVATLKSLVRNMISGVTEGYRYKMRLVHAHFPINVVIPKDGRSVEVK
NFLGGKQAKKVELLPGCTVRMNPDLKDELIFEGIDNQHVSLGCAQISQVCKIGDKDNRKF
LDGIYVSEKGRQ