Identifiers and Description

Gene Model Identifier

Contig22518.0.g91

Standard Name

RPL8

Aliases

Contig22518_0_g91

Description

Ribosomal Proteins L2, C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03947 ) Ribosomal Proteins L2, C-terminal domain
  • ( pfam00181 ) Ribosomal Proteins L2, RNA binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007162404.9996115996408327e-110Ribosomal Proteins L2, C-termi
nal domain cont...
SGDYIL018W9.998285701479858e-93RPL2B SGDID:S000001280, Chr IX
from 316768-316771,31717...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22518.0.g91(coding)
ATGGAAATAGTTTAGAAGTTTGATAGAAACTTGAGTGAATTACATCGATAGAGAGAGAAA
TCTTATATTATTTTAAGAAGTATTGACATTAATAATGGGAAGAGTCATTAGAAGTAAGCT
TCGACATATCATTCGCGCTAATCGATTTCCTAACCAATTTGTTTACTATAGCCCAGAGAA
AGGGAGCAAGCACAATTTTCAAAGCTCACACTTCGAAGAGAATCGCACCAGCTCAATTCA
GAACTCTTGATTTCGCCGAGAGAGAAGGGTAAGATCACACCATCCTTAATCATTGATCCT
ATTAGGTACATCAAGGGAGTTGTGTAGGAAATCGTTCACGATCCAGGCCGTGGTGCACCT
CTTGCCAAAGTTATTTTCAGAGACCCATATAAGTTCAAGCACAGAACTGAGTATTTCGTT
GCTGTTGAGGGACTCTACACTGGTCAATTCATCTACGCCGGTTCCAAGGCTGCTCTCTCC
GTTGGCAATATCTTACCAGTCAACCAACTCCCAGAAGGTACCATCGTATCCAACTGTGAG
GCTAAGACCGGAGACAGAGGCTCTTTCGCTAGAGCTTCAGGCTGCTCAACCGTCATCATC
GGTCACTCCGACGACGGAAAGAAGACCAGAGTTAGACTTCCATCCGGAACCAGAAGAACC
GTTCCAGGCAACTGCAGAGCCATGGTTGGAGTTGTTGCTGGTGGTGGAAGAACCGACAAG
CCAATTTGCAAAGCTGGTAACTCATACTACAGATGGAAAGCAAAGAGAAGAGGAACCTGG
CCAAGAGTTAGAGGTGTTGCTATGAACCCCGTAGACCATCCCCATGGTGGTGGTAACCAA
CAACATATCGGTCATCCCTCAACCGTGAGCAGATTCGCCTCACACGGTCAAAAGGTCGGT
CTTATCGCCGCCAGAAGAACTGGTCTCATTAGAGGAGGTAAAAAGGATCTCAAGATTCAA
AAGGAATGA


>Contig22518.0.g91(protein)
MEIVQKFDRNLSELHRQREKSYIILRSIDINNGKSHQKQASTYHSRQSISQPICLLQPRE
REQAQFSKLTLRRESHQLNSELLISPREKGKITPSLIIDPIRYIKGVVQEIVHDPGRGAP
LAKVIFRDPYKFKHRTEYFVAVEGLYTGQFIYAGSKAALSVGNILPVNQLPEGTIVSNCE
AKTGDRGSFARASGCSTVIIGHSDDGKKTRVRLPSGTRRTVPGNCRAMVGVVAGGGRTDK
PICKAGNSYYRWKAKRRGTWPRVRGVAMNPVDHPHGGGNQQHIGHPSTVSRFASHGQKVG
LIAARRTGLIRGGKKDLKIQKE