Identifiers and Description

Gene Model Identifier

Contig8661.0.g92

Standard Name

RPL7L1

Aliases

Contig8661_0_g92

Description

Ribosomal protein L30p/L7e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00327 ) Ribosomal protein L30p/L7e
  • ( pfam14121 ) Domain of unknown function (DUF4289)
  • ( pfam09288 ) Fungal ubiquitin-associated domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009719301.000382677035467e-28hypothetical protein
SGDYPL198W7.000924640675686e-24RPL7B SGDID:S000006119, Chr XV
I from 173152-173162,1735...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8661.0.g92(coding)
ATGGAAAACCTAGACGTATCCCAGGAAGCCCTCTTAAAGAAGAGAAAGAGAGACGACGAA
AACCAGAGAAAGAGACTGCACATCCGTGCTCAGTAGAGAATGGAAGTTGGCAGAAAGAAG
AAGATGGAGGACAAGGAGACCACCGGCAAGAAGATCTTAATGCCTGAGGTCTTTATCAGT
AATTACATGAAGCAGCAGAGGAATTATCAAAAGTATAAGAGAGAGAAAGGAAAGACCTCA
AAGATTGTTGATGGAAAGCTAAGCTCCCTAAACCCAAATGAAAGAATGAAGGCAAACACC
TTGATCCTCGCTGTTAGAGTAAAGCAATCAGACAACACAACTCCCCAGGCTCAGAAAATC
TTGAGAACTCTTGGATTAAAGGAGCTAAACAATGCTGTTTTATTGAAAAGTGATCCCGAT
ACCGAGAAACAATTGATTATTATTCAAGACTATATCGCATATGGATACCCAACCAAGCAA
GTTGTTAACGATTTGATCAGAAAGAGAGGAAACATTAAGAAGGAAGGCAAAAGATTAGCA
ATTTCTGATAACAACTTAATCGAAGAACTTTTAGGCGCACATGGAATTATTTGCTTAGAA
GATTTGATAGACTCAGCAATTAGATGCAATGTGAAGGACTCACATTTCGAAGAAGTCAGA
CAAGTTTTGTGGCCATTCCAATTGACACCTCAATAAGAGACTAGCGACAAGACCGATACT
AAGCGCAAAGACACTGGAAAAGTACTTAAGAAGAAGGATGTCAAGGTTGAGAAAGGTGGT
TATTTGGGACTTATGGGTGAGAAAATTAACGATTTTGTTAAGCCACTTATCTGA


>Contig8661.0.g92(protein)
MENLDVSQEALLKKRKRDDENQRKRLHIRAQQRMEVGRKKKMEDKETTGKKILMPEVFIS
NYMKQQRNYQKYKREKGKTSKIVDGKLSSLNPNERMKANTLILAVRVKQSDNTTPQAQKI
LRTLGLKELNNAVLLKSDPDTEKQLIIIQDYIAYGYPTKQVVNDLIRKRGNIKKEGKRLA
ISDNNLIEELLGAHGIICLEDLIDSAIRCNVKDSHFEEVRQVLWPFQLTPQQETSDKTDT
KRKDTGKVLKKKDVKVEKGGYLGLMGEKINDFVKPLI