Identifiers and Description

Gene Model Identifier

Contig19853.0.g31

Standard Name

RPL7A

Aliases

Contig19853_0_g31

Description

Ribosomal protein L7Ae/L30e/S12e/Gadd45 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01248 ) Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
  • ( pfam08228 ) RNase P subunit Pop3

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLL045C5.9988196117913e-83RPL8B SGDID:S000003968, Chr XI
I from 48629-47859, Genom...
T. thermophilaTTHERM_007733406.00073507697681e-75Ribosomal protein L7Ae contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19853.0.g31(coding)
ATGGTGGTTGCCTCAACTGGAGCTAAGGCTGGCTCAAAGGGAGGTAAAAGCCCATTGTTC
GAGAAGAATGCTCGCAACTTTAGAATCGGAGGAGACATCCAACCAAAGAGAGATCTCACT
CGCTTCGTCAGATGGCCTAAATATATTCGCATCCAGCGTCAAAAGAGAATTCTTCTTCAG
AGACTCAAGGTGCCCCCCGCTCTCCACCAATTCTCAAAGACTATCGACAGAAACCAAGCT
TCTCAACTTCTTAAATTACTTGCAAAATACAAGCCAGAGACCAAGGTCGAAAAGAAGACC
AGACTTCAAAAGGAAGCTGAGACCAAGAAGGCCGGTGGTGATGCCAAGAAGGGTGCCAAG
CCATACGTTCTTAAGTTCGGTCTTAACCACGTTACCACTCTCATCGAAGAGGGTAAGGCA
AAGCTCGTCGTTATCGCTCACGACGTTGACCCAATTGAATTGATGTCTTTCCTTCCAGCT
CTCTGCAGAAAGAAGGGTATTCCCTATGCCTTCGTTAAGGGTAAGGCCAGACTTGGACAA
CTCGTTCATCAAAAGACTGCCACCTGCGTTGCTGTTACCGATGTCAGAAAGGAAGACTAT
CAAGATCTCGAGAACCTCGCCAAGAACTTCAGAGCTCAATTCAACGACAACGAATCACTC
AGAAGAAACTGGAGCACTGGTGTTATGGGTATTAAGAACCAACACATGATGGCTCACAGA
GAAAGACTCAGAGAGATCGAGCTCCAAAAGAAGGCTAACATGTGA


>Contig19853.0.g31(protein)
MVVASTGAKAGSKGGKSPLFEKNARNFRIGGDIQPKRDLTRFVRWPKYIRIQRQKRILLQ
RLKVPPALHQFSKTIDRNQASQLLKLLAKYKPETKVEKKTRLQKEAETKKAGGDAKKGAK
PYVLKFGLNHVTTLIEEGKAKLVVIAHDVDPIELMSFLPALCRKKGIPYAFVKGKARLGQ
LVHQKTATCVAVTDVRKEDYQDLENLAKNFRAQFNDNESLRRNWSTGVMGIKNQHMMAHR
ERLREIELQKKANM