Identifiers and Description

Gene Model Identifier

Contig21038.0.g42

Standard Name

RPL7

Aliases

Contig21038_0_g42

Description

Ribosomal protein L30p/L7e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007211502.0004907641180118e-81ribosomal protein L30p/L7e con
taining protein
SGDYGL076C3.000809166761476e-75RPL7A SGDID:S000003044, Chr VI
I from 364964-364335,3655...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21038.0.g42(coding)
ATGCCAAGAGTTGTCCCTGAGAACGTCTAAAAGAAGCAAGCTAGAGACGCCAAGTTATTG
AAGGAGCTCAAGGAGAGAAGAGATAGAGAGAGAAAGGAGAGAGCTGAGAAGAGAAAGCAA
GTTGCTGTCAATGCTGAAAAATACTACAATGAGTACCAAGCTCAAGAGAAGACTCTTGTT
TCCAACCTCAGACAAGCCAAGGCCTCAGGTAATTTCTTCGTTCCCGCTGAAGCCAAGGTT
GCTTTCGCCATCAGAACCAGAGGTATCAACAAGCTCGACCCCAAGTGCAAAAAGATCATG
CAACTCCTCAGATTGAGACAATTGCACAACGGTGTGTTCGTGAGATTGAACAAGGCAACC
ATCAACATGCTCAGAAGAGTTGAGCCATACATCACCTATGGTTATCCTTCTCAATAAACC
ATTGCCAAGCTTGTTTACAAGAGAGGTTACGGTAAGGTCAACGGATCAAGAATCCCACTC
ACTGACAACGCCATCGTTGAGAACTCCCTCACCAAGCAAGGACTTTCAAGCGTTGAAGAT
CTTATTCACGAGATTGCTACTGTCGGCCCTCACTTCAAGGAAGCTAACAACTTCCTCTGG
CCATTCAAGCTCAACTCCCCAAGAAAGGGCTTCGCTGAGAAGAGACATCCTTATCAAAAT
GGTGGCGTTTGGGGCAACAGAGAGGACCAAATCAACGAATTGGTCAGAAGAATGCTTTGA


>Contig21038.0.g42(protein)
MPRVVPENVQKKQARDAKLLKELKERRDRERKERAEKRKQVAVNAEKYYNEYQAQEKTLV
SNLRQAKASGNFFVPAEAKVAFAIRTRGINKLDPKCKKIMQLLRLRQLHNGVFVRLNKAT
INMLRRVEPYITYGYPSQQTIAKLVYKRGYGKVNGSRIPLTDNAIVENSLTKQGLSSVED
LIHEIATVGPHFKEANNFLWPFKLNSPRKGFAEKRHPYQNGGVWGNREDQINELVRRML