Identifiers and Description

Gene Model Identifier

Contig12123.0.g11

Standard Name

RPL6

Aliases

Contig12123_0_g11

Description

Ribosomal protein L6e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001361201.0000099287337047e-53hypothetical protein
SGDYLR448W2.999661265281073e-47RPL6B SGDID:S000004440, Chr XI
I from 1028854-1028868,10...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12123.0.g11(coding)
ATGAGAAATTAATTGAGTTAGAGAGCAGAAATGGTTAAGAAGTTCAGTTGGTACCCCGCA
GATGACGAGATGAAGCACTATAAGAAGAGCAAGCCCAAGAGCACCAAATTGAGAAGAGGT
CTTGTTCCAGGTAGCGTACTCATCCTTCTTTCAGGTAGATTCAGAGGCAAGAGAGTTGTG
TTCCTCAAGCAACTCACCTCAGGCCTTCTCCTTGTTACCGGCCCCTACAAGGTCAACGGT
GTTCCCCTCAAGAGAGTCAACCAAGCCTACACCATCACCACCAGCACCAAGATTAACATC
GGTAGCGTTGATGTCGCCAAGGTCGATGATGCTTTGTTCAAGAAGAGCACATAGAGCAAA
AAGCAAGGTGAAGACAAGTTCTTCGCTGAAGCTGGCAAGAAGAAGGAAGTCTCAAAGGAG
AGATTAGACGCTCAAAAGGCTGTTGACACTGCCATCTTAAAGATCGTCAAGGAGTCAGGT
GAACCACTCCTCAGAAAGTATCTCAATGCTCGTTTCACCCTTGCAAACAACGACAAACCA
CACGCTTTGAGATTCTGA


>Contig12123.0.g11(protein)
MRNQLSQRAEMVKKFSWYPADDEMKHYKKSKPKSTKLRRGLVPGSVLILLSGRFRGKRVV
FLKQLTSGLLLVTGPYKVNGVPLKRVNQAYTITTSTKINIGSVDVAKVDDALFKKSTQSK
KQGEDKFFAEAGKKKEVSKERLDAQKAVDTAILKIVKESGEPLLRKYLNARFTLANNDKP
HALRF