Identifiers and Description

Gene Model Identifier

Contig22366.0.g46

Standard Name

RPL5

Aliases

Contig22366_0_g46

Description

Ribosomal L18p/L5e family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00861 ) Ribosomal L18p/L5e family
  • ( pfam14204 ) Ribosomal L18 C-terminal region
  • ( pfam08625 ) Utp13 specific WD40 associated domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007364804.000477177765533e-93Ribosomal L18p/L5e family prot
ein
SGDYPL131W2.0001503375893664e-79RPL5 SGDID:S000006052, Chr XVI
from 303121-304014, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22366.0.g46(coding)
ATGGGTTTCATTAAGACCGTGAAAACATCACCATATTACTCAAGATATCAAGTTAAGTTC
AGAAGAAGAAGAGAAGGAAAGACTGACTACTACGCCAGAAGAAGACTCGTCCAACAAGAC
AAGAACAAGTACGACTCAAAGAAATATAGACTTGTGGTCAGAAGAACTAACAGAAGAGTC
ATCACTCAAATTATCTTTGCCACAATCAAGGGTGATAGAGTGCTCTGCCAAGCTGACTCA
TTCGAGCTAAAGAAATTCGGTCTCGAAGCTGGTCTTACCAACTACGCTGCTGCTTACGCA
ACTGGTCTCCTCTTAGCCAGAAGACTCCTCACCGACTTGGGCATGGCAGACATGTACAAG
GGTGTTGAATCTGCTGATGGTGAATTCTTCGATGTCACTGAAAAGGGTGTCAACGACAAC
AGAAGACCATTCAAGGCTCTCCTCGATGTTGGTCTCGTTAGAACCACCACCGGTAACAGA
GTCTTCGGTGCTCTCAAGGGTGCTGTTGATGGTGGAGTTTACGTTCCCCACAACACCAAG
AGATTCCCAGGATATCACCTCGAAAAGGCTTAAACTCAAACCGGAAAGAGAGGTAAAGTT
GTCGAAAAGGGCAAAGCTGCTGGTACTTACAATGCTAAGGAACACAGAGAACACATCTTC
GGTCTCCACGTCCAAACCTATATGGATAAGCTCAAGAAGGAAGATGCTTCAAGATTCGCT
AAGCAATTCTCCAAGTGGGACGCCAACCTTAAGACTGCTAAAGTCGCTAACTTGGAAGCT
CTTTACAAAAAAATTCACTCCGATATCAGAAAGGGACCCAAGAGAGTTAAGGCTGAGAGA
AAGCAAGCTGCCGTAAGAAAGCAAATCACCAAGGAAAACGGAAGCCTCGTTCTCCAAAAC
TCTAAGGGCAAGAAGTGGTTGAGACAATTCAAACTCACCAAGGCACAAAGAACCGCCAGA
GTTGCTGCCAAGATCCAAAAGGCTCTCTCCAAGAAATGA


>Contig22366.0.g46(protein)
MGFIKTVKTSPYYSRYQVKFRRRREGKTDYYARRRLVQQDKNKYDSKKYRLVVRRTNRRV
ITQIIFATIKGDRVLCQADSFELKKFGLEAGLTNYAAAYATGLLLARRLLTDLGMADMYK
GVESADGEFFDVTEKGVNDNRRPFKALLDVGLVRTTTGNRVFGALKGAVDGGVYVPHNTK
RFPGYHLEKAQTQTGKRGKVVEKGKAAGTYNAKEHREHIFGLHVQTYMDKLKKEDASRFA
KQFSKWDANLKTAKVANLEALYKKIHSDIRKGPKRVKAERKQAAVRKQITKENGSLVLQN
SKGKKWLRQFKLTKAQRTARVAAKIQKALSKK