Identifiers and Description

Gene Model Identifier

Contig15450.0.g41

Standard Name

RPL3L

Aliases

Contig15450_0_g41

Description

Ribosomal protein L3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004978802.0009356157506544e-160ribosomal protein L3 containin
g protein
SGDYOR063W5.997537942519205e-151RPL3 SGDID:S000005589, Chr XV
from 444686-445849, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15450.0.g41(coding)
ATGTCTCACAGAAAGTACGAATGCCCAAGATCAGGCTCTCTCGCCTACTTGCCAAGAAGA
AGAACAAGACACCATAGAGGCAGAATACGATCTTTCCCAAGAGATGACGTCAAGGCCCCA
ATCCATCTCACCGCCTTCGTTGGTTACAAAGCTGGTATGACCCACGTCGCCAGACATCAC
GAAAAGAGAGAAGGTAAGAAGGTCATCAAGAGAGATATCGTTGAGCCAGTTACCGTCATT
GAAACCCCACCAATGAAAATTGTTGGTCTCGTTGGTTACATCGAAACCCCAAGAGGACTC
AGAGCACTCGCCACCGTCTGGGCTCAACACATCCCCGACCAAGTCAAGAGAAGATTCTAC
AAGAACTGGTGCCAATCAAAGAAGAAGGCCTTCACCAAGTACGCCCAAAGATGGTAAGAA
GATGACAAGAGCAAGAAATCAATCAAGAGAGATCTCGAGAGAATCAAGAAGTACTGCCAA
GTCGTCAGAGTACTCACCTCAACCCAACTCGACAAGCTCAACTTCAGACAAAGAAAGGCT
CACCTCATTGAAATCCAAGTTAACGGAGGTACCGTCGCCCAAAAGGTCGACTGGTCATTC
GCTAAATTCGAAAGCGAAGTTTCAGTTGCTGAGATCTTCAACGACAACGAAATGATCGAT
ACCATTGGTGTGACTAAGGGTTACGGAACCGAAGGTGTTATCAAGAGATTCGGTGTTACT
AGAATGCCCAGAAAGACTCACAGAGGTCTTAGAAAGGTCGGTTGTATCGGTGCTTGGCAT
CCAGCTGCCGTTAAGTGGACCGTCGCCAGAAGAGGTCAACTCGGTTATCATTCAAGAACT
GAATAAAACAAGAAAATCTACAGAGTAGGTGCTGGTGCAGTTAGAGGTGTTAAGAACAAC
GCCACTACTGAGGCTGATGCCATTGAGAAGAACATCACCCCACTTGGTGGTTTCCCTCAC
TATGGTGTCGTCAACAACGACTTCGTTATGGTTAAGGGTTGCGTTATGGGAACCAAGAAG
AGACCTGTCATTCTCAGAAAGTCAATCTTCCCACAAACCACCAACGCCGCTCTCGAGAAG
ATGGAAATCAAGTTCATCGATACCTCTTCAAAGATCGGTCACGGTAAATTCCAAACCGTC
GAGGAGAAAGACAAGTTCCTCGGACCCCTTGCCTCAAAGAACAGAGCAAAGTGA


>Contig15450.0.g41(protein)
MSHRKYECPRSGSLAYLPRRRTRHHRGRIRSFPRDDVKAPIHLTAFVGYKAGMTHVARHH
EKREGKKVIKRDIVEPVTVIETPPMKIVGLVGYIETPRGLRALATVWAQHIPDQVKRRFY
KNWCQSKKKAFTKYAQRWQEDDKSKKSIKRDLERIKKYCQVVRVLTSTQLDKLNFRQRKA
HLIEIQVNGGTVAQKVDWSFAKFESEVSVAEIFNDNEMIDTIGVTKGYGTEGVIKRFGVT
RMPRKTHRGLRKVGCIGAWHPAAVKWTVARRGQLGYHSRTEQNKKIYRVGAGAVRGVKNN
ATTEADAIEKNITPLGGFPHYGVVNNDFVMVKGCVMGTKKRPVILRKSIFPQTTNAALEK
MEIKFIDTSSKIGHGKFQTVEEKDKFLGPLASKNRAK