Identifiers and Description

Gene Model Identifier

Contig6413.0.g98

Standard Name

RPL38

Aliases

Contig6413_0_g98

Description

Ribosomal L38e protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR325C0.00000000002000577768187062RPL38 SGDID:S000004317, Chr XI
I from 781379-781143, Gen...
T. thermophilaTTHERM_008127800.000000019990673443141236hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6413.0.g98(coding)
ATGCCAAAGGAAATTAAGGACTTGAAGGAATTCATCAAGATTGTGAGAAGAGAGCAAAAG
AACCTCCCAAGTGCCCAAAAGATCACTATCAAGAAGAACAAGAAGAACGGCATCACTAAG
TTCAAGCTCAGAACATCCAGATACCTCTTCACCCTCAAGGTTGACGACAAGGTCAAGGCC
GATAAGATCATGCAATCCATCCCACCAACCCTCAAGAGAGAAAACAAGAACTGA


>Contig6413.0.g98(protein)
MPKEIKDLKEFIKIVRREQKNLPSAQKITIKKNKKNGITKFKLRTSRYLFTLKVDDKVKA
DKIMQSIPPTLKRENKN