Identifiers and Description

Gene Model Identifier

Contig19246.0.g31

Standard Name

RPL37A

Aliases

Contig19246_0_g31

Description

Ribosomal L37ae protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01780 ) Ribosomal L37ae protein family
  • ( pfam12760 ) Transposase zinc-ribbon domain
  • ( pfam02892 ) BED zinc finger
  • ( pfam14445 ) Prokaryotic RING finger family 2
  • ( pfam08792 ) A2L zinc ribbon domain
  • ( pfam13005 ) putative Helix-turn-helix domain of transposase IS66
  • ( pfam09723 ) Zinc ribbon domain
  • ( pfam13465 ) Zinc-finger double domain
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam00096 ) Zinc finger, C2H2 type

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000756701.999002769139511e-37hypothetical protein
SGDYPR043W5.998312950603665e-35RPL43A SGDID:S000006247, Chr X
VI from 654166-654167,654...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19246.0.g31(coding)
ATGGCAAAGAGAACAAAGAAGGTCGGCATTGTTGGCAAATACGGTACTAGATATGGTGCT
GCTCAGAGAAAAACCATCAAAAAGTTCGAGATCACCCAAAGAGCTACTTATACTTGCACA
TTCTGCGGAAAGGACGCCGTAAGAAGATCAGCAGTCGGTATCTGGAAATGCAGAGGTTGC
AAAAAGACCCTTGCTGGTGGAGCTTGGTAGGTCTCAACTGCCGCTGCTCTTACTGCTAAG
GCCACCGTTACACGTCTCAGAAGATTAAGAGAAGAAGCTGCCAAGGAGACTGGTCCTCAG
TGA


>Contig19246.0.g31(protein)
MAKRTKKVGIVGKYGTRYGAAQRKTIKKFEITQRATYTCTFCGKDAVRRSAVGIWKCRGC
KKTLAGGAWQVSTAAALTAKATVTRLRRLREEAAKETGPQ