Identifiers and Description

Gene Model Identifier

Contig1196.1.g75

Standard Name

RPL37

Aliases

Contig1196_1_g75

Description

Ribosomal protein L37e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR185W1.0004572433669413e-23RPL37A SGDID:S000004175, Chr X
II from 522663-522669,523...
T. thermophilaTTHERM_010681803.9983110956465888e-22Ribosomal protein L37e contain
ing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1196.1.g75(coding)
ATGACAAAGGGAACTCAGTCAAACGGAAAGAAGAACAGCAAGACTCACACTCTTAGTAGA
GTTACCGGTACCTAATCATGGCACAAGCAAAAGAAGAGATGCGCCAAGTCTGGTCACGGT
GCAGGCACCAAGTTGAGAAGATACAACTGGGCCACCAAAGCTATAAGAAGAAGAACCACT
GGCACTGGCAGAATGAGTTACTTGAAACATATCCCTAGAAGAGCAAAGAACGGTTTCAGA
GAAGGCACAAAAGCCGTGTCAATCAAGAGAAAGGCACCCGTCGCAAAATGA


>Contig1196.1.g75(protein)
MTKGTQSNGKKNSKTHTLSRVTGTQSWHKQKKRCAKSGHGAGTKLRRYNWATKAIRRRTT
GTGRMSYLKHIPRRAKNGFREGTKAVSIKRKAPVAK