Identifiers and Description

Gene Model Identifier

Contig2601.0.g107

Standard Name

RPL36

Aliases

Contig2601_0_g107

Description

Ribosomal protein L36e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011296602.9990874792167046e-33Ribosomal protein L36e contain
ing protein
SGDYPL249C-A 186.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2601.0.g107(coding)
ATGGAAAGCAAGACTGGAATCTTCGTTGGCTTGAACAAGGGCTTCATCGTCACCAAACCC
AAGGTTAACACCCGTAAACTAAAGGCTTCCTACAGAAAGGGTAAGCTCGGAAAGAGAGTT
GCCATGGTCAGAGAGGTTATCCGTGAAGTCTCAGGACTCGCCCCATACGAGCGCAAGATG
ATTGAATTGATCCGTACTGGAGTCGCCACCAAGGAAAAGAAGGCAGTCAAGCTCGCCAGA
AGAAGACTCGGTACCCACAAGAGAGCTCAAATTAAGAGAGATGAGATCAACGACATGATC
AGAGCTCAAAAGAGAAAGTGA


>Contig2601.0.g107(protein)
MESKTGIFVGLNKGFIVTKPKVNTRKLKASYRKGKLGKRVAMVREVIREVSGLAPYERKM
IELIRTGVATKEKKAVKLARRRLGTHKRAQIKRDEINDMIRAQKRK