Identifiers and Description

Gene Model Identifier

Contig19397.0.g64

Standard Name

RPL35A

Aliases

Contig19397_0_g64

Description

Ribosomal protein L35Ae

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009927302.0006622580855403e-35hypothetical protein
SGDYPL143W6.0002282540086176e-27RPL33A SGDID:S000006064, Chr X
VI from 282122-282140,282...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19397.0.g64(coding)
ATGGGCAAAGACGCTGATAAACAAACTAAAAGAGTTCACAAGAAGACTCAACCAGTCAGA
TTGTACACCAAGGCAGTGTTCACTGGTTTCAAAAGAGGAATTACCACCCAGCATGAACAA
TTCGCTCTTCTCAAGATCAAGGGTGTGAATGATAAGAAAGACACTTCCTTCTACTTCGGA
AAGAGAGTCGCTTACATCTACAAGGCCAAGAACACCATCAACAACTCCAGATTCAGAACC
ATCTGGGGCAGAGTCGTCAAGCCACACGGAAACAACGGTGCAGTCAGAGCAAAGTTCGCA
AGAAATCTACCACCCAGAGCTATGGGAGCAACCCTTAGAGTCATGCTCTTCCCCAACAGA
GCTATCTGA


>Contig19397.0.g64(protein)
MGKDADKQTKRVHKKTQPVRLYTKAVFTGFKRGITTQHEQFALLKIKGVNDKKDTSFYFG
KRVAYIYKAKNTINNSRFRTIWGRVVKPHGNNGAVRAKFARNLPPRAMGATLRVMLFPNR
AI