Identifiers and Description

Gene Model Identifier

Contig1454.1.g21

Standard Name

RPL35

Aliases

Contig1454_1_g21

Description

Ribosomal L29 protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005616806.001249495680822e-29hypothetical protein
SGDYDL191W1.0002124404074584e-26RPL35A SGDID:S000002350, Chr I
V from 117664-117666,1181...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1454.1.g21(coding)
ATGCAAAGAGTGAAAGCCCACGAACTCAGACAAAAAGACGAGAAATCTCTTGTTGATGAA
CTCACCAAATTCAGAAAAGAATTGGCTCAATTGAGAGTTAGCAAGGTCTCCGCCGCTCCC
CAGGTCAAGCTCGCAAGAATAAGAGTTGTTAGAAAGGCTATTGCCAAGGTCTTGACTGTG
ATCAACGAGAAGAGAAGAGATCAAGCCAGAGTCGACCACAAGAAGAAGAGAACCCCCTCT
GACTTGAGACACAAGAAGACCAGAGCTTTCAGAAGAAGATTGACCAAGCACGAGACAACA
AGAAAAACTGTTAGACAACAAAAGAGAGACTCCAACTTCAGACCCAGAAAGTTCGCCCTC
GCCGCATGA


>Contig1454.1.g21(protein)
MQRVKAHELRQKDEKSLVDELTKFRKELAQLRVSKVSAAPQVKLARIRVVRKAIAKVLTV
INEKRRDQARVDHKKKRTPSDLRHKKTRAFRRRLTKHETTRKTVRQQKRDSNFRPRKFAL
AA